RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G367580
Reference: TK1151 Chr: Chr02 Coordinates: 93524211-93527538 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1251 bp · TkA02G367580|TK1151|cDNA

ATGACAGAGCATTCAAGTAAGGTACACATAATTGTTGGATCACTTGGTGGTTTTGTCTTCTTCCTTCTTGTTGCTTCTGGGTTATTTTATTGTCGATTGAAGAAGTGTAAGAAGAATAAAGAAGAGTTGAAGGGGGCTGACGCTGTTAACTACAATGATAAATATCTACGGTTGGCAACCAATAATTTCACTGAAGAGAATAGTATAGGGAGAGGTGGATTTGGTGAAGTATTCAAGGCAATACATGATAATAACCAAGT...

CDS

Download CDS FASTA

1176 bp · TkA02G367580|TK1151|CDS

ATGACAGAGCATTCAAGTAAGGTACACATAATTGTTGGATCACTTGGTGGTTTTGTCTTCTTCCTTCTTGTTGCTTCTGGGTTATTTTATTGTCGATTGAAGAAGTGTAAGAAGAATAAAGAAGAGTTGAAGGGGGCTGACGCTGTTAACTACAATGATAAATATCTACGGTTGGCAACCAATAATTTCACTGAAGAGAATAGTATAGGGAGAGGTGGATTTGGTGAAGTATTCAAGGCAATACATGATAATAACCAAGT...

Protein

Download Protein FASTA

391 aa · TkA02G367580|TK1151|PROTEIN

MTEHSSKVHIIVGSLGGFVFFLLVASGLFYCRLKKCKKNKEELKGADAVNYNDKYLRLATNNFTEENSIGRGGFGEVFKAIHDNNQVLAVKKLEVGDAKAKLEFENEVLLISQIHHRNLLRLLGWSTEGSNLLLVLEYMPNGSLDSFLWGSKRRSLNWKQRFDIILGIARGLAHLHNECHVKIIHRDIKSSNILLDDHFQPKIADFGLAKFQPEDQTHVVTTFAGTLGYAAPEYAVNGHLSDKVDTYSLGVVMLEIISCR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G367580
TK1151 IDTkA02G367580
OH-1004 IDLXL04_015108
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)94.500
Protein coverage (%)TK1151 97.187 / OH-1004 62.871
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G367580
LocationChr02:93524211-93527538 (-)
DescriptionSimilar to CRK3: Cysteine-rich receptor-like protein kinase 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g56130 Probable LRR receptor-like serine/threonine-protein kinase At1g56130. No verified direct reference in this release
At1g56140 Probable LRR receptor-like serine/threonine-protein kinase At1g56140. No verified direct reference in this release
At1g70520 Cysteine-rich receptor-like protein kinase 2. No verified direct reference in this release
At1g53420 Probable LRR receptor-like serine/threonine-protein kinase At1g53420. No verified direct reference in this release
At5g40380 Cysteine-rich receptor-like protein kinase 42. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015108 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0007165 signal transduction Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0010193 response to ozone Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0052545 callose localization Biological Process
GO:0072593 reactive oxygen species metabolic process Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005829 cytosol Cellular Component
KEGG gene cross-reference
ath:AT1G19090
ath:AT1G70520
ath:AT1G70530
ath:AT4G23230
ath:AT5G40380
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.768
Rank 1 · TkA02G367580 · TK1151
Cytoplasm0.149
Rank 2 · TkA02G367580 · TK1151
Nucleus0.085
Rank 3 · TkA02G367580 · TK1151
Endoplasmic reticulum0.084
Rank 4 · TkA02G367580 · TK1151
Golgi apparatus0.037
Rank 5 · TkA02G367580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29364TED611-41 aa
PF00069Pkinase63-330 aa
PF03109ABC165-91 aa
PF07714PK_Tyr_Ser-Thr66-331 aa
PF26433WH_HI_009673-111 aa
PF01636APH78-176 aa
PF14531Kinase-like152-274 aa
PF12330Haspin_kinase156-220 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G367580PF29364TED611410.01715.7
TkA02G367580PF00069Pkinase633301.1e-48166.6
TkA02G367580PF03109ABC165910.1811.6
TkA02G367580PF07714PK_Tyr_Ser-Thr663312.7e-46158.7
TkA02G367580PF26433WH_HI_0096731110.008717.2
TkA02G367580PF01636APH781760.1112.9
TkA02G367580PF14531Kinase-like1522740.01415.3
TkA02G367580PF12330Haspin_kinase1562200.06313.0
TkA02G367580PF01636APH1632100.1112.9
TkA02G367580PF03109ABC11782160.1811.6
TkA02G367580PF17667Pkinase_fungal1802310.04613.2
TkA02G367580PF26433WH_HI_00962593090.008717.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
C0LGH2Arabidopsis thalianasp|C0LGH2|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g5613044.500%Swiss-ProtMedium
C0LGH3Arabidopsis thalianasp|C0LGH3|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g5614043.900%Swiss-ProtMedium
Q9CAL3Arabidopsis thalianasp|Q9CAL3|CRK2_ARATH Cysteine-rich receptor-like protein kinase 240.900%Swiss-ProtMedium
C0LGG7Arabidopsis thalianasp|C0LGG7|Y1534_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g5342042.500%Swiss-ProtMedium
Q9FNE1Arabidopsis thalianasp|Q9FNE1|CRK42_ARATH Cysteine-rich receptor-like protein kinase 4246.400%Swiss-ProtMedium

JBrowse

View in Genome Browser