TkA02G362390 | RubberDandelionOmics

Gene overview

TkA02G362390

Reference: TK1151 Chr: Chr02 Coordinates: 92169321-92173652 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

974 bp · TkA02G362390|TK1151|cDNA

AAAAAACAAATTGAAAGAGTACATTAGTCATTGCGACCAACTCACAAAAAATCTAGAATCGCTTCTCAATTTGAAGCCTTTTTGTACCGATCGAATTTTGTTTAGAAGTCACAGTGATTTCTTTACAGTTTCTTTAATGATTATAAAGAGAGAAGCATTGAACCCCACCTCAGCCGCCTCACTCATTACTATATTTTAACGCACACATATCTGAAATCCTAAAGAATGAAACCCATGGATGATGTATGGAAAGACATCAG...

CDS

Download CDS FASTA

522 bp · TkA02G362390|TK1151|CDS

ATGAAACCCATGGATGATGTATGGAAAGACATCAGCAGCCTTCCATCTCTTCACCACCCTACCGCCACCCATCACTTCCAAGATTTCTTTGCTCCGGCTGCAGCCAGGCCTGGTGGAAGTGGCGGTACTGGACCCACCCTCCACCACCCTTCTCCACCGTCACCGTCACCGCCACCACCACCACCCACCACCATGTTAAGCCTGAGTACTTCTGGTAACTCAGGACACGATCAAGAACCAACACCTAATAATTCATCAAC...

Protein

Download Protein FASTA

173 aa · TkA02G362390|TK1151|PROTEIN

MKPMDDVWKDISSLPSLHHPTATHHFQDFFAPAAARPGGSGGTGPTLHHPSPPSPSPPPPPPTTMLSLSTSGNSGHDQEPTPNNSSTGATSPVSNQRSPPEYSDKFKRLMKNRESAARSRARKQVRADELEQEVLRLTKENANLKRLQKEFCSASTAQFPKKPKLHRTRSAPF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G362390`
TK1151 ID	TkA02G362390
OH-1004 ID	LXL04_015140
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G362390

Location Chr02:92169321-92173652 (+)

Description Similar to FD: Protein FD

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35900`	Transcription factor required for the transition to flowering promoted by FT.	No verified direct reference in this release
`At2g17770`	Transcription factor required for the transition to flowering promoted by FT.	No verified direct reference in this release
`At3g56850`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter.	No verified direct reference in this release
`At2g41070`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015140 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009648 photoperiodism Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010115 regulation of abscisic acid biosynthetic process Biological Process

GO:0010255 glucose mediated signaling pathway Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G45249

ath:AT2G17770

ath:AT2G41070

ath:AT3G56850

ath:AT4G35900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA02G362390 · TK1151

Cytoplasm0.092

Rank 2 · TkA02G362390 · TK1151

Cell membrane0.030

Rank 3 · TkA02G362390 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA02G362390 · TK1151

Plastid0.008

Rank 5 · TkA02G362390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07586HXXSHH3-25 aa

PF16101PRIMA149-74 aa

PF07586HXXSHH64-143 aa

PF12325TMF_TATA_bd103-153 aa

PF07716bZIP_2105-146 aa

PF14197Cep57_CLD_2105-143 aa

PF00170bZIP_1106-146 aa

PF03131bZIP_Maf107-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G362390	`PF07586`	HXXSHH	3	25	0.16	12.2
TkA02G362390	`PF16101`	PRIMA1	49	74	2.1	8.8
TkA02G362390	`PF07586`	HXXSHH	64	143	0.16	12.2
TkA02G362390	`PF12325`	TMF_TATA_bd	103	153	0.036	14.9
TkA02G362390	`PF07716`	bZIP_2	105	146	1.3e-09	38.6
TkA02G362390	`PF14197`	Cep57_CLD_2	105	143	0.085	13.7
TkA02G362390	`PF00170`	bZIP_1	106	146	2.9e-10	40.8
TkA02G362390	`PF03131`	bZIP_Maf	107	157	0.04	15.2
TkA02G362390	`PF28121`	VPA1267	109	149	0.064	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JK2`	Arabidopsis thaliana	sp\|Q84JK2\|FD_ARATH Protein FD	56.500%	Swiss-Prot	Low
`Q7PCC6`	Arabidopsis thaliana	sp\|Q7PCC6\|FDP_ARATH bZIP transcription factor 27	50.700%	Swiss-Prot	Low
`Q9LES3`	Arabidopsis thaliana	sp\|Q9LES3\|AI5L2_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 2	55.100%	Swiss-Prot	Low
`Q9C5Q2`	Arabidopsis thaliana	sp\|Q9C5Q2\|AI5L3_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 3	55.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card