TkA02G361000 | RubberDandelionOmics

Gene overview

TkA02G361000

Reference: TK1151 Chr: Chr02 Coordinates: 91790403-91800429 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2279 bp · TkA02G361000|TK1151|cDNA

TGTATATGTATATATAGTCCTCTGTTGTTCTCCAAGAAGAACAACAAACTTTTCTTCCAGAAAATGGGAACCCAAAAGGAAACTATGCTTGAAGAAATGAAAACACGTTTAGATGAGAAAAAGGTTTTTTCTTCTGGGAAAGAGAGAGCTCCATTGTTTGGTTGGCCATGGCAGAATCTGTCAAACTTCAAGTACTTGTTGTACGGGCCACTTCTTGCTGAGTTCATATATTCAAGAATCTATGGAAAGAAGCACAGTGA...

CDS

Download CDS FASTA

1251 bp · TkA02G361000|TK1151|CDS

ATGGGAACCCAAAAGGAAACTATGCTTGAAGAAATGAAAACACGTTTAGATGAGAAAAAGGTTTTTTCTTCTGGGAAAGAGAGAGCTCCATTGTTTGGTTGGCCATGGCAGAATCTGTCAAACTTCAAGTACTTGTTGTACGGGCCACTTCTTGCTGAGTTCATATATTCAAGAATCTATGGAAAGAAGCACAGTGAGTATAGTTGGTGTTTGCATATTCTAATATTGTCTTCACTAAGAGGACTTGTGCACCAGCTATG...

Protein

Download Protein FASTA

416 aa · TkA02G361000|TK1151|PROTEIN

MGTQKETMLEEMKTRLDEKKVFSSGKERAPLFGWPWQNLSNFKYLLYGPLLAEFIYSRIYGKKHSEYSWCLHILILSSLRGLVHQLWSSYNNMLFLNRNHRLSEKGIDFDQIDKEWHWDNFILLEAFVASIILLINPSISNLPIWKTSGITACIIFHVGLSEPLYYWLHRLLLHSPSFFQQYHWLHHSSQVNHPFTAGHATLLEHLLLCVIMGVPLVGTALIGQGSVILFYGYVLIFDFLRCMGHSNIEVVPHHIFHTMP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G361000`
TK1151 ID	TkA02G361000
OH-1004 ID	LXL04_031990
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 84.856 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G361000

Location Chr02:91790403-91800429 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57800`	Involved in cuticule membrane and wax production, and in the typhine and sporopollenin biosynthesis of pollen.	Cloning and characterization of the WAX2 gene of Arabidopsis involved in cuticle membrane and wax production.2003 · DOI: 10.1105/tpc.010926 A novel male-sterile mutant of Arabidopsis thaliana, faceless pollen-1, produces pollen with a smooth surface and an acetolysis-sensitive exine.2003 · DOI: 10.1023/b:plan.0000009269.97773.70

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Z1F5`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release
`Os09g0426800`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release
`Os06g0653000`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release
`Os02g0178800`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	Characterization of Glossy1-homologous genes in rice involved in leaf wax accumulation and drought resistance.2009 · DOI: 10.1007/s11103-009-9483-0
`UniProt: B8AIW3`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031990 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008610 lipid biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0043447 alkane biosynthetic process Biological Process

GO:0046184 aldehyde biosynthetic process Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT5G57800

dosa:Os02g0178800

dosa:Os09g0426800

osa:4328496

osa:4347115

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.842

Rank 1 · TkA02G361000 · TK1151

Nucleus0.094

Rank 2 · TkA02G361000 · TK1151

Golgi apparatus0.068

Rank 3 · TkA02G361000 · TK1151

Cytoplasm0.063

Rank 4 · TkA02G361000 · TK1151

Cell membrane0.042

Rank 5 · TkA02G361000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04116FA_hydroxylase65-75 aa

PF04116FA_hydroxylase156-296 aa

PF21745PMI1_PMIR1-2_C236-261 aa

PF21745PMI1_PMIR1-2_C279-315 aa

PF04116FA_hydroxylase344-390 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G361000	`PF04116`	FA_hydroxylase	65	75	2.4e-16	61.1
TkA02G361000	`PF04116`	FA_hydroxylase	156	296	2.4e-16	61.1
TkA02G361000	`PF21745`	PMI1_PMIR1-2_C	236	261	0.055	14.7
TkA02G361000	`PF21745`	PMI1_PMIR1-2_C	279	315	0.055	14.7
TkA02G361000	`PF04116`	FA_hydroxylase	344	390	2.4e-16	61.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1Z0`	Arabidopsis thaliana	sp\|Q8H1Z0\|CER3_ARATH Very-long-chain aldehyde decarbonylase CER3	55.500%	Swiss-Prot	High
`A2Z1F5`	Oryza sativa subsp. indica	sp\|A2Z1F5\|GLO11_ORYSI Very-long-chain aldehyde decarbonylase GL1-1	49.100%	Swiss-Prot	Medium
`Q69PA8`	Oryza sativa subsp. japonica	sp\|Q69PA8\|GLO11_ORYSJ Very-long-chain aldehyde decarbonylase GL1-1	49.100%	Swiss-Prot	Medium
`Q67WQ7`	Oryza sativa subsp. japonica	sp\|Q67WQ7\|GLO13_ORYSJ Very-long-chain aldehyde decarbonylase GL1-3	47.400%	Swiss-Prot	Medium
`Q6ETL8`	Oryza sativa subsp. japonica	sp\|Q6ETL8\|GLO12_ORYSJ Very-long-chain aldehyde decarbonylase GL1-2	48.100%	Swiss-Prot	Medium
`B8AIW3`	Oryza sativa subsp. indica	sp\|B8AIW3\|GLO12_ORYSI Very-long-chain aldehyde decarbonylase GL1-2	72.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card