RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G360800
Reference: TK1151 Chr: Chr02 Coordinates: 91722270-91724849 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

952 bp · TkA02G360800|TK1151|cDNA

ATGATCTTTTTCGATTTCATATTCAAGAAGAAGGACGCACCACCTCCTGGACACTTTTTACGATTGGGGAAACCAAGGGCTCAAGACGATCTAATTTTGAGGAAGAGAGATAGGATGCAGAGGTGGCTGTGTTGTACTTGTCAAGTTGAAGAGTCCTACCCTTCAAACGAAAATGGATTTACAAAAAACCACAATGATCACACTGATGGAATTCCAGCACAGCTTGCCAACTTAACTAATCTGAAAATATTGTATTTATC...

CDS

Download CDS FASTA

522 bp · TkA02G360800|TK1151|CDS

ATGATCTTTTTCGATTTCATATTCAAGAAGAAGGACGCACCACCTCCTGGACACTTTTTACGATTGGGGAAACCAAGGGCTCAAGACGATCTAATTTTGAGGAAGAGAGATAGGATGCAGAGGTGGCTGTGTTGTACTTGTCAAGTTGAAGAGTCCTACCCTTCAAACGAAAATGGATTTACAAAAAACCACAATGATCACACTGATGGAATTCCAGCACAGCTTGCCAACTTAACTAATCTGAAAATATTGTATTTATC...

Protein

Download Protein FASTA

173 aa · TkA02G360800|TK1151|PROTEIN

MIFFDFIFKKKDAPPPGHFLRLGKPRAQDDLILRKRDRMQRWLCCTCQVEESYPSNENGFTKNHNDHTDGIPAQLANLTNLKILYLSYNKMSGIVPAGLAHNPKLTYLYLDHNQLSGRIPEAFYKHPYLKELYIEGNAFRPGVNPIGIHKISFLDRTKESGVCTFVDLHPYHP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G360800
TK1151 IDTkA02G360800
OH-1004 IDLXL04_004198
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)86.800
Protein coverage (%)TK1151 39.306 / OH-1004 15.297
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G360800
LocationChr02:91722270-91724849 (+)
DescriptionSimilar to PTI13: PTI1-like tyrosine-protein kinase 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g59350 Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors (e.g. PYL8/RCAR3, PYR1/RCAR11, PYL1/RCAR12, PYL3/RCAR13 and PYL2/RCAR14) to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses. No verified direct reference in this release
At2g43230 Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.
CARK6 is involved in abscisic acid to regulate stress responses in Arabidopsis thaliana.2019 · DOI: 10.1016/j.bbrc.2019.03.180
Catalytically inactive subgroup VIII receptor-like cytoplasmic kinases regulate the immune-triggered oxidative burst in Arabidopsis thaliana.2025 · DOI: 10.1093/jxb/erae486

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004198 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0010029 regulation of seed germination Biological Process
GO:0010375 stomatal complex patterning Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0090333 regulation of stomatal closure Biological Process
GO:1901653 cellular response to peptide Biological Process
GO:2000037 regulation of stomatal complex patterning Biological Process
GO:2000038 regulation of stomatal complex development Biological Process
GO:2000070 regulation of response to water deprivation Biological Process
GO:2000280 regulation of root development Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT1G06700
ath:AT2G30740
ath:AT3G59350
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.814
Rank 1 · TkA02G360800 · TK1151
Cytoplasm0.090
Rank 2 · TkA02G360800 · TK1151
Nucleus0.036
Rank 3 · TkA02G360800 · TK1151
Cell membrane0.029
Rank 4 · TkA02G360800 · TK1151
Endoplasmic reticulum0.027
Rank 5 · TkA02G360800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00560LRR_164-78 aa
PF23211LRR_LRWD168-141 aa
PF12799LRR_471-90 aa
PF13855LRR_874-115 aa
PF13516LRR_678-92 aa
PF12799LRR_479-115 aa
PF00560LRR_180-101 aa
PF13516LRR_6101-117 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G360800PF00560LRR_164786.5e-1140.9
TkA02G360800PF23211LRR_LRWD1681410.02315.1
TkA02G360800PF12799LRR_471901.4e-1454.5
TkA02G360800PF13855LRR_8741155.5e-1349.2
TkA02G360800PF13516LRR_678922e-0525.0
TkA02G360800PF12799LRR_4791151.4e-1454.5
TkA02G360800PF00560LRR_1801016.5e-1140.9
TkA02G360800PF13516LRR_61011172e-0525.0
TkA02G360800PF12799LRR_41031371.4e-1454.5
TkA02G360800PF00560LRR_11041246.5e-1140.9
TkA02G360800PF13855LRR_81201385.5e-1349.2
TkA02G360800PF13516LRR_61261382e-0525.0
TkA02G360800PF00560LRR_11291436.5e-1140.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
B9DFG5Arabidopsis thalianasp|B9DFG5|CARK5_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 553.700%Swiss-ProtLow
Q9ZW72Arabidopsis thalianasp|Q9ZW72|CARK6_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 660.900%Swiss-ProtLow

JBrowse

View in Genome Browser