TkA02G359530 | RubberDandelionOmics

Gene overview

TkA02G359530

Reference: TK1151 Chr: Chr02 Coordinates: 91362706-91370412 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4583 bp · TkA02G359530|TK1151|cDNA

GTTTTACTATTGACTTTTTTCTACAAACACGTACGTTACCCTAATTTTGTCTCACTTCATCTGGCCGGAGATGAAGACTTTTCTCCCGTCTACCTTCCTCTCTCTTTCCTCGCAGTACCATATATATACACCCAAAAAGTGTCTTAACATTCATTATTTCATTCTTCAAGATAAGATTTGCTAACCAGATGGATCAACAAAAGGCATCAGCAAAGTCAAAGAACACACTCATGAAGTTTCTACCAAGAGCAACATCATCG...

CDS

Download CDS FASTA

2571 bp · TkA02G359530|TK1151|CDS

ATGTGTGATGCAATAACAATGGCTAGCGACGATTCCGACTCAGATCCGATCATTTTTCTTCATGGAGTTCTGGAATTTACGATAGCCGAAGCTCAATGTTTGCCGAACATGGACGTATTGACGCAACGCGTTCGACGTTGCTTAAACGCCCTCGAGCCTTCCAAACCACCGACAGCGCCAACGAAGAAAGGAACGCCGCGCCGACGTCGATTCGTTACCTGTGATCCGTACGCATCCGTCTGTCTCGCCGGTGCCACTGT...

Protein

Download Protein FASTA

856 aa · TkA02G359530|TK1151|PROTEIN

MCDAITMASDDSDSDPIIFLHGVLEFTIAEAQCLPNMDVLTQRVRRCLNALEPSKPPTAPTKKGTPRRRRFVTCDPYASVCLAGATVARTRVIANSQDPVWDEHFVTPVAHPVSQVEIQIKDNDVFGAELIGVAMISAERIESGELIDDWFPIIGPSGKQPKPNCAIRLQLQFTSCEEQNEKSKMDGEEYFCLRDSYFPVRAGGTVTLYQDAHTVEGTLPEIELDGGEEGGECNFFKQRGCWEDICHAILEAHHLVYIVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G359530`
TK1151 ID	TkA02G359530
OH-1004 ID	LXL04_015159
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 98.131 / OH-1004 69.421 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G359530

Location Chr02:91362706-91370412 (-)

Description Similar to PLDDELTA: Phospholipase D delta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35790`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	Involvement of a novel Arabidopsis phospholipase D, AtPLDdelta, in dehydration-inducible accumulation of phosphatidic acid in stress signalling.2001 · DOI: 10.1046/j.1365-313x.2001.01060.x Kinetic analysis of Arabidopsis phospholipase Ddelta. Substrate preference and mechanism of activation by Ca2+ and phosphatidylinositol 4,5-biphosphate.2002 · DOI: 10.1074/jbc.m209598200
`At2g42010`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At4g00240`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At4g11850`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	Expression and characterization of Arabidopsis phospholipase Dgamma2.2006 · DOI: 10.1016/j.bbalip.2006.09.017
`At4g11840`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015159 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006643 membrane lipid metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009395 phospholipid catabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010044 response to aluminum ion Biological Process

GO:0012501 programmed cell death Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0046470 phosphatidylcholine metabolic process Biological Process

GO:0046473 phosphatidic acid metabolic process Biological Process

KEGG gene cross-reference

ath:AT2G42010

ath:AT4G00240

ath:AT4G11840

ath:AT4G11850

ath:AT4G35790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.486

Rank 1 · TkA02G359530 · TK1151

Cell membrane0.268

Rank 2 · TkA02G359530 · TK1151

Nucleus0.215

Rank 3 · TkA02G359530 · TK1151

Golgi apparatus0.138

Rank 4 · TkA02G359530 · TK1151

Lysosome / Vacuole0.125

Rank 5 · TkA02G359530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C265-152 aa

PF00614PLDc248-845 aa

PF13091PLDc_2288-373 aa

PF00168C2296-314 aa

PF13091PLDc_2556-575 aa

PF13091PLDc_2705-745 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G359530	`PF00168`	C2	65	152	1.3e-15	58.2
TkA02G359530	`PF00614`	PLDc	248	845	1.6e-214	714.1
TkA02G359530	`PF13091`	PLDc_2	288	373	2e-09	38.0
TkA02G359530	`PF00168`	C2	296	314	1.3e-15	58.2
TkA02G359530	`PF13091`	PLDc_2	556	575	2e-09	38.0
TkA02G359530	`PF13091`	PLDc_2	705	745	2e-09	38.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5Y0`	Arabidopsis thaliana	sp\|Q9C5Y0\|PLDD1_ARATH Phospholipase D delta	60.700%	Swiss-Prot	High
`P93733`	Arabidopsis thaliana	sp\|P93733\|PLDB1_ARATH Phospholipase D beta 1	53.200%	Swiss-Prot	High
`O23078`	Arabidopsis thaliana	sp\|O23078\|PLDB2_ARATH Phospholipase D beta 2	52.500%	Swiss-Prot	High
`Q9T053`	Arabidopsis thaliana	sp\|Q9T053\|PLDG1_ARATH Phospholipase D gamma 1	50.300%	Swiss-Prot	High
`Q9T052`	Arabidopsis thaliana	sp\|Q9T052\|PLDG3_ARATH Phospholipase D gamma 3	49.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card