TkA02G358380 | RubberDandelionOmics

Gene overview

TkA02G358380

Reference: TK1151 Chr: Chr02 Coordinates: 91038423-91041148 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

967 bp · TkA02G358380|TK1151|cDNA

AACCTCAGTTGAGGTTTATATTTTTAAATTTAGTAGTTCAGGCCTTCTAGCATCCTTGATACTTTCAAGTTATCTTTCTAGTGACTTAGAAACCATAAAGGCGATAAGTTATGAGAGCTCCGAAATGGGATGCACGATTAGGCTTAAACAGAGGTAAGTGGACTGCCGAAGAAGATGAAAAGTTATTAACCTACATCAGTAAATACGGCATTTGGAATTGGTGTAAGATGCCTCCGTATGCAGGTCTTTCCAGAACCGGA...

CDS

Download CDS FASTA

687 bp · TkA02G358380|TK1151|CDS

ATGAGAGCTCCGAAATGGGATGCACGATTAGGCTTAAACAGAGGTAAGTGGACTGCCGAAGAAGATGAAAAGTTATTAACCTACATCAGTAAATACGGCATTTGGAATTGGTGTAAGATGCCTCCGTATGCAGGTCTTTCCAGAACCGGAAAAAGTTGCAGGTTAAGATGGATGAATTATTTGAAGCCAAATATAAAACGAGGAAATTTCACAAGTGAAGACGAAGAAACAATAATTCATTACCATTCAATTCTAGGGAA...

Protein

Download Protein FASTA

228 aa · TkA02G358380|TK1151|PROTEIN

MRAPKWDARLGLNRGKWTAEEDEKLLTYISKYGIWNWCKMPPYAGLSRTGKSCRLRWMNYLKPNIKRGNFTSEDEETIIHYHSILGNRWSAIAKKIPGRTDNEVKNYWHAHLMKKQMAKYPISETKPANIQTSNNDVESSIKSTIDHFVSSITEDYNTSSCMLHKYDRCEHKPIKLETSHDMSSPGTVEDIESLWQQLYANNQDIELQNLLEDTFSCESIGFSNSNNM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G358380`
TK1151 ID	TkA02G358380
OH-1004 ID	LXL04_015179
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 50.000 / OH-1004 89.062 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G358380

Location Chr02:91038423-91041148 (-)

Description Similar to MYB15: Transcription factor MYB15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23250`	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance.	A R2R3 type MYB transcription factor is involved in the cold regulation of CBF genes and in acquired freezing tolerance.2006 · DOI: 10.1074/jbc.m605895200 Transgenic expression of MYB15 confers enhanced sensitivity to abscisic acid and improved drought tolerance in Arabidopsis thaliana.2009 · DOI: 10.1016/s1673-8527(09)60003-5
`At2g31180`	Transcription activator that regulates freezing tolerance by affecting expression of CBF genes.	AtMYB14 Regulates Cold Tolerance in Arabidopsis. 2013 · DOI: 10.1007/s11105-012-0481-z
`At4g05100`	Probable transcription factor that may function in salt stress response.	Salt-induced transcription factor MYB74 is regulated by the RNA-directed DNA methylation pathway in Arabidopsis.2015 · DOI: 10.1093/jxb/erv312

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0624300`	Acts as a negative regulator of cold tolerance.	The OsMYB30 Transcription Factor Suppresses Cold Tolerance by Interacting with a JAZ Protein and Suppressing β-Amylase Expression.2017 · DOI: 10.1104/pp.16.01725
`Os04g0517100`	Transcriptional activator involved in cold stress response.	Overexpression of the rice Osmyb4 gene increases chilling and freezing tolerance of Arabidopsis thaliana plants.2004 · DOI: 10.1046/j.1365-313x.2003.01938.x Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development.2010 · DOI: 10.1111/j.1365-3040.2010.02221.x The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants.2012 · DOI: 10.1007/s13353-011-0081-x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015179 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050826 response to freezing Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G31180

ath:AT3G23250

ath:AT4G05100

dosa:Os02g0624300

dosa:Os04g0517100

osa:4330027

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.892

Rank 1 · TkA02G358380 · TK1151

Cytoplasm0.223

Rank 2 · TkA02G358380 · TK1151

Mitochondrion0.029

Rank 3 · TkA02G358380 · TK1151

Cell membrane0.018

Rank 4 · TkA02G358380 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA02G358380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding14-61 aa

PF23588HTH_CHD1_Hrp315-40 aa

PF09111SLIDE15-36 aa

PF23082Myb_DNA-binding_216-32 aa

PF13921Myb_DNA-bind_617-75 aa

PF09111SLIDE60-96 aa

PF00249Myb_DNA-binding67-112 aa

PF13921Myb_DNA-bind_670-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G358380	`PF00249`	Myb_DNA-binding	14	61	4.8e-34	116.9
TkA02G358380	`PF23588`	HTH_CHD1_Hrp3	15	40	0.0036	18.0
TkA02G358380	`PF09111`	SLIDE	15	36	0.11	13.3
TkA02G358380	`PF23082`	Myb_DNA-binding_2	16	32	0.013	16.3
TkA02G358380	`PF13921`	Myb_DNA-bind_6	17	75	9.2e-21	74.5
TkA02G358380	`PF09111`	SLIDE	60	96	0.11	13.3
TkA02G358380	`PF00249`	Myb_DNA-binding	67	112	4.8e-34	116.9
TkA02G358380	`PF13921`	Myb_DNA-bind_6	70	124	9.2e-21	74.5
TkA02G358380	`PF23082`	Myb_DNA-binding_2	87	104	0.013	16.3
TkA02G358380	`PF23082`	Myb_DNA-binding_2	111	123	0.013	16.3
TkA02G358380	`PF03659`	Glyco_hydro_71	115	203	0.011	15.2
TkA02G358380	`PF09111`	SLIDE	130	154	0.11	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTC4`	Arabidopsis thaliana	sp\|Q9LTC4\|MYB15_ARATH Transcription factor MYB15	59.500%	Swiss-Prot	Medium
`Q9SJX8`	Arabidopsis thaliana	sp\|Q9SJX8\|MYB14_ARATH Transcription factor MYB14	55.000%	Swiss-Prot	Medium
`Q9M0Y5`	Arabidopsis thaliana	sp\|Q9M0Y5\|MYB74_ARATH Transcription factor MYB74	56.300%	Swiss-Prot	Medium
`Q6K1S6`	Oryza sativa subsp. japonica	sp\|Q6K1S6\|MYB30_ORYSJ Transcription factor MYB30	60.000%	Swiss-Prot	Medium
`Q7XBH4`	Oryza sativa subsp. japonica	sp\|Q7XBH4\|MYB4_ORYSJ Transcription factor MYB4	61.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card