TkA02G357880 | RubberDandelionOmics

Gene overview

TkA02G357880

Reference: TK1151 Chr: Chr02 Coordinates: 90900187-90906472 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3498 bp · TkA02G357880|TK1151|cDNA

GTTACGTATAATTTACTAAAGTAGCCTTTTCGAATTAAAGAGGATTTACTTACGATTAAATAGCATTAAATATTCCAAAACCCTAGTTAGGTGAATTACAAAACCAATTGAACTATAGAATTTCCTCGTATTCTTCCACCATCAATATGGAGCATTGACATCAAATCACAAGCTCTTAAACTTTGTTCTAACCATCATCCTGTTAGTATTTCTCTATCACCTTGTCTTATTGTTCAGTTTCTTCAACTCCCAGGAAAGGT...

CDS

Download CDS FASTA

2385 bp · TkA02G357880|TK1151|CDS

ATGGCGGGTGGTGCCAGAGCTCAAGTGAACAAGTCGCATAAGACGCGATTTGCTTCGAAATCCTCTCGCAATGTTCACAAAACGTCTGTCAAAGAAAAGAGCAAGATTAACAAACCTGATCGCAATGCCATGAAGGGAGCTCGGGCTGCTCGACTACAACGAAACAAAATGTTGAGAGAGCAGAAGAAAGCTACCCTTTTAAAAGAGAAAAGGAGTTCTAGTGGAACAGCCAGTGCCCCTCGTGTTATTGTTTTATTTGG...

Protein

Download Protein FASTA

794 aa · TkA02G357880|TK1151|PROTEIN

MAGGARAQVNKSHKTRFASKSSRNVHKTSVKEKSKINKPDRNAMKGARAARLQRNKMLREQKKATLLKEKRSSSGTASAPRVIVLFGLSASTNISSLASDLLALLSSDNNPTQYPAVASSEYRLRATVLEAPHGDFMACMDMAKVADLFVFVASGNCSSEKDSSNYYMDEFGSRCLSVFRALGLPTSAVFLRDLPCDLKRRNDIKKTCISSLSSEFSEDCKFYPADTKDDLHKFMMLFKEQRVTIPHWRTQRPYIMAQKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G357880`
TK1151 ID	TkA02G357880
OH-1004 ID	LXL04_015189
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G357880`
Location	Chr02:90900187-90906472 (+)
Description	Similar to tsr1: Pre-rRNA-processing protein TSR1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015189` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000479 endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0030686 90S preribosome Cellular Component GO:0030688 preribosome, small subunit precursor Cellular Component GO:0003723 RNA binding Molecular Function GO:0003924 GTPase activity Molecular Function GO:0005525 GTP binding Molecular Function GO:0034511 U3 snoRNA binding Molecular Function
KEGG gene cross-reference	dme:Dmel_CG7338 hsa:55720 mmu:104662 pon:100174068 xla:495115 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.889

Rank 1 · TkA02G357880 · TK1151

Cytoplasm0.172

Rank 2 · TkA02G357880 · TK1151

Mitochondrion0.032

Rank 3 · TkA02G357880 · TK1151

Cell membrane0.021

Rank 4 · TkA02G357880 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA02G357880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04950RIBIOP_C12-68 aa

PF22298Tsr1_G-like81-233 aa

PF08142AARP2CN246-308 aa

PF04950RIBIOP_C487-783 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G357880	`PF04950`	RIBIOP_C	12	68	6.8e-108	361.2
TkA02G357880	`PF22298`	Tsr1_G-like	81	233	1.2e-05	26.0
TkA02G357880	`PF08142`	AARP2CN	246	308	5.9e-21	74.6
TkA02G357880	`PF04950`	RIBIOP_C	487	783	6.8e-108	361.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card