TkA02G355120 | RubberDandelionOmics

Gene overview

TkA02G355120

Reference: TK1151 Chr: Chr02 Coordinates: 90204732-90216506 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4423 bp · TkA02G355120|TK1151|cDNA

ATAACATAAATAACCCTCACCCTCCAAAAAGCCCACTACGATATCTCCACAATGGATATAAAAAATTAAAACCCCATTATTATCTATTATTAATTCAAGTTGAGTCTGCGACTCTTCACTTAAATTCAGTGCTATAAATTCCTTAAATTCTCCTTCTCTCTCTCCGTCACCCAACTCCCAAGGCCCAACGCCGCCTGTCGCCGGGGCTATTTGCAGCATCTGCTCGGTGGTTTACGAAACGACAGCGGTGGTAGTACCGT...

CDS

Download CDS FASTA

2067 bp · TkA02G355120|TK1151|CDS

ATGATGAAGCTCTCTTTGCGGCTATACACGGCGGTTGCTTATTTTCAGATCTTGTTGTTTGTATCTATTGGGAATGCAGATAGATCTGATAACAGAATACTTTTGACATCCAATGACACACAAAGGGAAAAACACGGTGAAGAATATTGTGCAATGTATGATATATGTGGATCACGTAGTGATGGAAAAGTACTGAATTGCCCTTTTGGTTCTCCATCTATAAAGCCAGATGATTTATTATCAGCTAAAATTCAGAGTTT...

Protein

Download Protein FASTA

688 aa · TkA02G355120|TK1151|PROTEIN

MMKLSLRLYTAVAYFQILLFVSIGNADRSDNRILLTSNDTQREKHGEEYCAMYDICGSRSDGKVLNCPFGSPSIKPDDLLSAKIQSLCPTISGNICCTEFQFDTLRSQVQQAIPFLVGCPACLRNFLNLFCELTCSPHQSQFINVTSITKIKENSTVGGIDYYITDSFGEGLFDSCKDVKFGTMNSRAIEFVGASAKNFKEWFAFIGRKAALSVPGSPYSINFRPDADVATGMKPMNVTTYSCGDTSLGCSCGDCPSSPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G355120`
TK1151 ID	TkA02G355120
OH-1004 ID	LXL04_015218
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.000
Protein coverage (%)	TK1151 99.273 / OH-1004 52.995 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G355120`
Location	Chr02:90204732-90216506 (+)
Description	Similar to Npc1: NPC intracellular cholesterol transporter 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015218` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006695 cholesterol biosynthetic process Biological Process GO:0006897 endocytosis Biological Process GO:0006914 autophagy Biological Process GO:0007041 lysosomal transport Biological Process GO:0008203 cholesterol metabolic process Biological Process GO:0008206 bile acid metabolic process Biological Process GO:0009101 glycoprotein biosynthetic process Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0010467 gene expression Biological Process GO:0010878 cholesterol storage Biological Process GO:0012501 programmed cell death Biological Process GO:0014850 response to muscle activity Biological Process
KEGG gene cross-reference	dme:Dmel_CG12092 hsa:4864 mmu:18145 rno:432367 ssc:397591 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.362

Rank 1 · TkA02G355120 · TK1151

Cell membrane0.358

Rank 2 · TkA02G355120 · TK1151

Cytoplasm0.170

Rank 3 · TkA02G355120 · TK1151

Golgi apparatus0.141

Rank 4 · TkA02G355120 · TK1151

Endoplasmic reticulum0.123

Rank 5 · TkA02G355120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16414NPC1_N48-281 aa

PF03024Folate_rec81-183 aa

PF02460Patched111-136 aa

PF12349Sterol-sensing289-311 aa

PF22314NPC1_MLD424-615 aa

PF02460Patched638-686 aa

PF12349Sterol-sensing659-686 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G355120	`PF16414`	NPC1_N	48	281	9.9e-66	222.6
TkA02G355120	`PF03024`	Folate_rec	81	183	0.00069	20.2
TkA02G355120	`PF02460`	Patched	111	136	4.8	7.6
TkA02G355120	`PF12349`	Sterol-sensing	289	311	0.15	12.7
TkA02G355120	`PF22314`	NPC1_MLD	424	615	6e-38	131.5
TkA02G355120	`PF02460`	Patched	638	686	4.8	7.6
TkA02G355120	`PF12349`	Sterol-sensing	659	686	0.15	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card