TkA02G351770 | RubberDandelionOmics

Gene overview

TkA02G351770

Reference: TK1151 Chr: Chr02 Coordinates: 89478520-89479107 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA02G351770|TK1151|cDNA

ATGATATCTGAACAACTACACGGCCAAACATCACATCAAGAACTCAAGGCTTCCAACCGCCATGGAACCCTAATGGAGGATGATGATGGTGATGACACAAATAATGTTTCCTTAACGTGTCTCAGTTTATACACCCGAGGTGGAGGGTGCCGAGTTGGAACCGCAACAACCGCCGAGTTCAGCGAACTCGGTACCAAACCCGCATGCGGGTCCCACAACACGAGTGTCGATTGTTTCTCATATGGAGTGGAGAAACTTTG...

CDS

Download CDS FASTA

588 bp · TkA02G351770|TK1151|CDS

ATGATATCTGAACAACTACACGGCCAAACATCACATCAAGAACTCAAGGCTTCCAACCGCCATGGAACCCTAATGGAGGATGATGATGGTGATGACACAAATAATGTTTCCTTAACGTGTCTCAGTTTATACACCCGAGGTGGAGGGTGCCGAGTTGGAACCGCAACAACCGCCGAGTTCAGCGAACTCGGTACCAAACCCGCATGCGGGTCCCACAACACGAGTGTCGATTGTTTCTCATATGGAGTGGAGAAACTTTG...

Protein

Download Protein FASTA

195 aa · TkA02G351770|TK1151|PROTEIN

MISEQLHGQTSHQELKASNRHGTLMEDDDGDDTNNVSLTCLSLYTRGGGCRVGTATTAEFSELGTKPACGSHNTSVDCFSYGVEKLWKKNHTKKNYLEVEESLTNTSKMHVFLPDDILEMCLMRLPLPSLMNTRLVCKKWRSLTTAPRFLQLRKDGFYPSPWLFLFGTVKDGYSSREIYAFDVSLKKWHKIELER

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G351770`
TK1151 ID	TkA02G351770
OH-1004 ID	LXL04_035768
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	51.800
Protein coverage (%)	TK1151 93.333 / OH-1004 32.668 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G351770

Location Chr02:89478520-89479107 (-)

Description Similar to At5g42350: F-box/kelch-repeat protein At5g42350

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42350`	F-box/kelch-repeat protein At5g42350.	No verified direct reference in this release
`At5g42360`	F-box/kelch-repeat protein At5g42360.	No verified direct reference in this release
`At2g24540`	Component of SCF (ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035768 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G30090

ath:AT2G24540

ath:AT5G15710

ath:AT5G42350

ath:AT5G42360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.712

Rank 1 · TkA02G351770 · TK1151

Cytoplasm0.206

Rank 2 · TkA02G351770 · TK1151

Cell membrane0.112

Rank 3 · TkA02G351770 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA02G351770 · TK1151

Plastid0.032

Rank 5 · TkA02G351770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like35-44 aa

PF00646F-box113-150 aa

PF12937F-box-like113-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G351770	`PF12937`	F-box-like	35	44	6.3e-07	29.8
TkA02G351770	`PF00646`	F-box	113	150	4.8e-11	42.8
TkA02G351770	`PF12937`	F-box-like	113	147	6.3e-07	29.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FII2`	Arabidopsis thaliana	sp\|Q9FII2\|FK117_ARATH F-box/kelch-repeat protein At5g42350	48.000%	Swiss-Prot	Medium
`Q9FII1`	Arabidopsis thaliana	sp\|Q9FII1\|FK118_ARATH F-box/kelch-repeat protein At5g42360	46.200%	Swiss-Prot	Medium
`Q8LAW2`	Arabidopsis thaliana	sp\|Q8LAW2\|AFR_ARATH F-box protein AFR	39.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card