TkA02G350810 | RubberDandelionOmics

Gene overview

TkA02G350810

Reference: TK1151 Chr: Chr02 Coordinates: 89216172-89223329 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1662 bp · TkA02G350810|TK1151|cDNA

ATGGCGGCGGGATCATCAAACGAGAGGTCATTGGAACAAACACCAACGTGGGCAGTGGCACTAGTTTGTACAGTCTTCGTTATTATCTCCGTCATCATTGAACATGGGATTCATTCTGTCAGCAAGTGGTTCCAAAAAAAGCAGAAGAAAGCAATGCTTGAAGCCCTAGAGAAAATAAAAGCAGAGCTCATGCTATTAGGGTTTTTATCATTGCTATTAACGGTGGGTACATCATACGTTGCAAAGATCTGTGTTCCCGA...

CDS

Download CDS FASTA

1662 bp · TkA02G350810|TK1151|CDS

ATGGCGGCGGGATCATCAAACGAGAGGTCATTGGAACAAACACCAACGTGGGCAGTGGCACTAGTTTGTACAGTCTTCGTTATTATCTCCGTCATCATTGAACATGGGATTCATTCTGTCAGCAAGTGGTTCCAAAAAAAGCAGAAGAAAGCAATGCTTGAAGCCCTAGAGAAAATAAAAGCAGAGCTCATGCTATTAGGGTTTTTATCATTGCTATTAACGGTGGGTACATCATACGTTGCAAAGATCTGTGTTCCCGA...

Protein

Download Protein FASTA

553 aa · TkA02G350810|TK1151|PROTEIN

MAAGSSNERSLEQTPTWAVALVCTVFVIISVIIEHGIHSVSKWFQKKQKKAMLEALEKIKAELMLLGFLSLLLTVGTSYVAKICVPEKIGYKMLPCKAKHYNAGHEGKGGGDEDGGGGDEGEHRRKLLNVAGDMIFRRVLAASSKDGGSCSKGMVQMISYSAVHQLHIFIFVLAVFHILYSVVIIGLGLAKMKKWQAWEAETTSLEYEFTNDPARFRFAHQTSFVKRHTGLSTKPGIRWVVAFFRQFFGSISKVDYLTIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G350810`
TK1151 ID	TkA02G350810
OH-1004 ID	LXL04_015264
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.300
Protein coverage (%)	TK1151 96.022 / OH-1004 46.673 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G350810

Location Chr02:89216172-89223329 (-)

Description Similar to MLO-H1: MLO protein homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11310`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YD22`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`Os06g0486300`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015264 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G61560

dosa:Os06g0486300

osa:4341067

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.860

Rank 1 · TkA02G350810 · TK1151

Cytoplasm0.098

Rank 2 · TkA02G350810 · TK1151

Endoplasmic reticulum0.089

Rank 3 · TkA02G350810 · TK1151

Lysosome / Vacuole0.041

Rank 4 · TkA02G350810 · TK1151

Golgi apparatus0.039

Rank 5 · TkA02G350810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03094Mlo8-502 aa

PF11779SPT_ssu-like17-32 aa

PF11779SPT_ssu-like51-82 aa

PF15990UPF0767317-344 aa

PF15990UPF0767422-472 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G350810	`PF03094`	Mlo	8	502	2.3e-219	729.5
TkA02G350810	`PF11779`	SPT_ssu-like	17	32	0.16	12.3
TkA02G350810	`PF11779`	SPT_ssu-like	51	82	0.16	12.3
TkA02G350810	`PF15990`	UPF0767	317	344	0.23	12.4
TkA02G350810	`PF15990`	UPF0767	422	472	0.23	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXB6`	Arabidopsis thaliana	sp\|Q9SXB6\|MLO2_ARATH MLO-like protein 2	49.600%	Swiss-Prot	Medium
`A2YD22`	Oryza sativa subsp. indica	sp\|A2YD22\|MLOH1_ORYSI MLO protein homolog 1	55.400%	Swiss-Prot	High
`Q0DC45`	Oryza sativa subsp. japonica	sp\|Q0DC45\|MLOH1_ORYSJ MLO protein homolog 1	55.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card