TkA02G349980 | RubberDandelionOmics

Gene overview

TkA02G349980

Reference: TK1151 Chr: Chr02 Coordinates: 88990625-88994438 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2692 bp · TkA02G349980|TK1151|cDNA

AAATAGTCTCAATAAAATGTCGTTGACGGTAACAGACGTTTCGTAAAGGATATTGGGTCAAGAAGAAACAACCCCAGCCTGAGAAATCGATAGAGAGACTCAAATTCTTCACAAAACAATTATTCACAAAACCCCACAAATTCTTTCGTCTGCTCAAATCAAAGATCCCTTTTTAAATAAATGGTGAATAATTTACAAGTTATTTCACTGTAATGAGAATGAGAGGACCTATAATTTCACTTTTGCGCCTTTTGGCCGTG...

CDS

Download CDS FASTA

684 bp · TkA02G349980|TK1151|CDS

ATGAGAATGAGAGGACCTATAATTTCACTTTTGCGCCTTTTGGCCGTGATTCCAGCGGCATATGGGAGTCTGCCGGTCCTCCCGCCGCCGTCAACAACTTCCGGTTCCTCTGTTCTGGATCAATTTCAGCTTCCGCCGCCGCTTCCAGCTAAGATCAACTCAACACCTAAACAGGATGCTATATTGGTGGCTGCTCCAGATGGCACATTATATCAAGTAGATATCAGTTCAGGTAAAATTCTTTGGTCTTTCCCATCTGG...

Protein

Download Protein FASTA

227 aa · TkA02G349980|TK1151|PROTEIN

MRMRGPIISLLRLLAVIPAAYGSLPVLPPPSTTSGSSVLDQFQLPPPLPAKINSTPKQDAILVAAPDGTLYQVDISSGKILWSFPSGAPIYDSQQSPNLEDDEHNSSRQKHNKFYIDCGDDWQLYIHSKDSKAEKLPFGAEELIGRTPHVSVDGVLLGSKKTTVFLVDPQTGKIVYTFKSNGGQSPENSSIILKKDADKWKEPTTLGFDHVDHDQLLYIKRWNARIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G349980`
TK1151 ID	TkA02G349980
OH-1004 ID	LXL04_015261
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.800
Protein coverage (%)	TK1151 99.559 / OH-1004 26.526 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G349980`
Location	Chr02:88990625-88994438 (+)
Description	Similar to IRE1B: Serine/threonine-protein kinase/endoribonuclease IRE1b
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015261` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation Biological Process GO:0002376 immune system process Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0006914 autophagy Biological Process GO:0006986 response to unfolded protein Biological Process GO:0008380 RNA splicing Biological Process GO:0009751 response to salicylic acid Biological Process GO:0030968 endoplasmic reticulum unfolded protein response Biological Process GO:0034263 positive regulation of autophagy in response to ER overload Biological Process GO:0034976 response to endoplasmic reticulum stress Biological Process GO:0036498 IRE1-mediated unfolded protein response Biological Process
KEGG gene cross-reference	ath:AT2G17520 ath:AT3G11870 ath:AT5G24360 dosa:Os07g0471000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.581

Rank 1 · TkA02G349980 · TK1151

Nucleus0.196

Rank 2 · TkA02G349980 · TK1151

Cytoplasm0.163

Rank 3 · TkA02G349980 · TK1151

Lysosome / Vacuole0.107

Rank 4 · TkA02G349980 · TK1151

Golgi apparatus0.098

Rank 5 · TkA02G349980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13570Beta-prop_ACSF437-182 aa

PF13360PQQ_255-173 aa

PF25292Beta-prop_CGLA57-91 aa

PF01011PQQ58-89 aa

PF25171Beta-prop_WDR36-Utp21_1st60-99 aa

PF07774EMC1_C61-181 aa

PF03413PepSY66-81 aa

PF22112OmcA-like_N113-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G349980	`PF13570`	Beta-prop_ACSF4	37	182	3.1e-06	27.5
TkA02G349980	`PF13360`	PQQ_2	55	173	0.0001	22.8
TkA02G349980	`PF25292`	Beta-prop_CGLA	57	91	0.0007	19.9
TkA02G349980	`PF01011`	PQQ	58	89	0.0019	17.7
TkA02G349980	`PF25171`	Beta-prop_WDR36-Utp21_1st	60	99	0.0013	19.0
TkA02G349980	`PF07774`	EMC1_C	61	181	0.0069	16.5
TkA02G349980	`PF03413`	PepSY	66	81	0.086	13.9
TkA02G349980	`PF22112`	OmcA-like_N	113	194	0.012	16.2
TkA02G349980	`PF01011`	PQQ	142	188	0.0019	17.7
TkA02G349980	`PF13360`	PQQ_2	148	181	0.0001	22.8
TkA02G349980	`PF25171`	Beta-prop_WDR36-Utp21_1st	152	182	0.0013	19.0
TkA02G349980	`PF25292`	Beta-prop_CGLA	153	194	0.0007	19.9
TkA02G349980	`PF03413`	PepSY	158	175	0.086	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card