TkA02G349800 | RubberDandelionOmics

Gene overview

TkA02G349800

Reference: TK1151 Chr: Chr02 Coordinates: 88941349-88946015 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3678 bp · TkA02G349800|TK1151|cDNA

ATGGTGATTAGCTGGTTGCTCAATTCATTACATCAAAATATTGCTGAGAGTGTGCTATTTCTTCAAACTGCTACTGAAATTTGGAATGAACTTCATCATCGTTATGAGCAAACTGATGGTGCTCTTATATATCAAGTTCAACAACAACTATATTCCTTATCCCAAGGATCTGATGATTTCTCTGTTTACTTCACCAAAATCATGAAAATATGGGATGAGCTTCGCATTGTTCAAGAGATTCCAGCATGTACATGTAATGC...

CDS

Download CDS FASTA

3678 bp · TkA02G349800|TK1151|CDS

ATGGTGATTAGCTGGTTGCTCAATTCATTACATCAAAATATTGCTGAGAGTGTGCTATTTCTTCAAACTGCTACTGAAATTTGGAATGAACTTCATCATCGTTATGAGCAAACTGATGGTGCTCTTATATATCAAGTTCAACAACAACTATATTCCTTATCCCAAGGATCTGATGATTTCTCTGTTTACTTCACCAAAATCATGAAAATATGGGATGAGCTTCGCATTGTTCAAGAGATTCCAGCATGTACATGTAATGC...

Protein

Download Protein FASTA

1225 aa · TkA02G349800|TK1151|PROTEIN

MVISWLLNSLHQNIAESVLFLQTATEIWNELHHRYEQTDGALIYQVQQQLYSLSQGSDDFSVYFTKIMKIWDELRIVQEIPACTCNAATNIRKFLEDQKLIQLLMGLNDTYKAIRAQILMMKPLPSVSTVYSMIIQEERQRGINLPTMLNHDAIAMNVANTQSQSNYSKKSLVCTQSKKEEPKATAHAHLATDSNNISQELYQHLLQLLNQSNIQHTSNSNASIHDGAMNPDDTGATDHMCSNSTLFVSMTKFSQPHKIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G349800`
TK1151 ID	TkA02G349800
OH-1004 ID	LXL04_022410
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	41.000
Protein coverage (%)	TK1151 98.694 / OH-1004 40.774 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G349800

Location Chr02:88941349-88946015 (+)

Description Similar to VIII-1: Myosin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release
`At4g02960`	Retrovirus-related Pol polyprotein from transposon RE2.	No verified direct reference in this release
`UniProt: P92519`	Uncharacterized mitochondrial protein AtMg00810.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022410 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0007015 actin filament organization Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0030048 actin filament-based movement Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048767 root hair elongation Biological Process

GO:0051645 Golgi localization Biological Process

GO:0051646 mitochondrion localization Biological Process

GO:0060151 peroxisome localization Biological Process

GO:0090436 leaf pavement cell development Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G50360

ath:AT3G19960

ath:AT4G27370

ath:AT5G43900

ath:AT5G54280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.655

Rank 1 · TkA02G349800 · TK1151

Nucleus0.497

Rank 2 · TkA02G349800 · TK1151

Mitochondrion0.071

Rank 3 · TkA02G349800 · TK1151

Peroxisome0.032

Rank 4 · TkA02G349800 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA02G349800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14223Retrotran_gag_24-141 aa

PF14223Retrotran_gag_2177-220 aa

PF22936Pol_BBD233-304 aa

PF00665rve347-432 aa

PF25597SH3_retrovirus506-565 aa

PF07727RVT_2712-978 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G349800	`PF14223`	Retrotran_gag_2	4	141	0.0001	22.9
TkA02G349800	`PF14223`	Retrotran_gag_2	177	220	0.0001	22.9
TkA02G349800	`PF22936`	Pol_BBD	233	304	2.5e-15	57.3
TkA02G349800	`PF00665`	rve	347	432	9.6e-08	32.9
TkA02G349800	`PF25597`	SH3_retrovirus	506	565	4.9e-19	68.6
TkA02G349800	`PF07727`	RVT_2	712	978	6.4e-70	236.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94HW2`	Arabidopsis thaliana	sp\|Q94HW2\|POLR1_ARATH Retrovirus-related Pol polyprotein from transposon RE1	33.900%	Swiss-Prot	Medium
`Q9ZT94`	Arabidopsis thaliana	sp\|Q9ZT94\|POLR2_ARATH Retrovirus-related Pol polyprotein from transposon RE2	32.900%	Swiss-Prot	Medium
`P92519`	Arabidopsis thaliana	sp\|P92519\|M810_ARATH Uncharacterized mitochondrial protein AtMg00810	38.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card