TkA02G349450 | RubberDandelionOmics

Gene overview

TkA02G349450

Reference: TK1151 Chr: Chr02 Coordinates: 88853493-88858226 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1954 bp · TkA02G349450|TK1151|cDNA

TTCAAAACAACGTAACTAAATCCCCTATTAACACTCTCGTTAATTCCTTCTTCTTCAATCATACCAAAATCCATCACACCCTTCTTAAAACATTTTCCGTTTCCATTTTCAATCTATTTTTTCTTTTCCCTCTCTGAAGAAAAACGAATCAATGGGATTTCTTTCGATCATCAATTGCAATTAAATCGTCTGCAATTCGTATTGAAAAACAGGAGAAACAAAACAAAGAAGCGATTAGAAGGATAATGATCTTGAAGCAA...

CDS

Download CDS FASTA

1473 bp · TkA02G349450|TK1151|CDS

ATGGGTGGAGATGAACGAATGCTCGATCAAACAGCAACGTGGTCCGTTGCTGTTGTTTGTGCAATCATTGTGATAGTTTCAATAGCGTTGGAGCATGTTCTCCACAGCATACATCATATTTTCAAAAAACGACATAAAGCGGGGCTATTGGAAGCACTTGACATCATCAAAAATGAGCTCATGGTACTTGGGTTTATATCGTTGCTTCTGGTGTTTTGCCAGAATTATATTGCGTCAATCTGTATTTCAAAGAAGCTTAC...

Protein

Download Protein FASTA

490 aa · TkA02G349450|TK1151|PROTEIN

MGGDERMLDQTATWSVAVVCAIIVIVSIALEHVLHSIHHIFKKRHKAGLLEALDIIKNELMVLGFISLLLVFCQNYIASICISKKLTKDFLPCKKEDYDKEEGGYDQDAKRRLLWYEQRRLGGGAPVECKEGYEEIISVAGLHQLHIFIFFLAVFHVFYSALTMIAGRAKTRKWKLWEKEILDELVPPDVADPTKYRLTKELSFVKHHTGSFTSTPAMFYLVCFFRQFFTSVRRSDYLAMRHAFFSVHLSPGSHFNFQKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G349450`
TK1151 ID	TkA02G349450
OH-1004 ID	LXL04_015266
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G349450

Location Chr02:88853493-88858226 (-)

Description Similar to MLO5: MLO-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33670`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At1g42560`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g17480`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At5g65970`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g17430`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015266 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G42560

ath:AT2G17430

ath:AT2G17480

ath:AT2G33670

ath:AT5G65970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.840

Rank 1 · TkA02G349450 · TK1151

Cytoplasm0.113

Rank 2 · TkA02G349450 · TK1151

Endoplasmic reticulum0.099

Rank 3 · TkA02G349450 · TK1151

Golgi apparatus0.045

Rank 4 · TkA02G349450 · TK1151

Lysosome / Vacuole0.044

Rank 5 · TkA02G349450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03094Mlo5-465 aa

PF04235DUF41813-75 aa

PF08510PIG-P15-70 aa

PF08510PIG-P150-162 aa

PF04235DUF418153-176 aa

PF04235DUF418373-408 aa

PF08510PIG-P401-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G349450	`PF03094`	Mlo	5	465	1.1e-188	628.2
TkA02G349450	`PF04235`	DUF418	13	75	0.041	14.5
TkA02G349450	`PF08510`	PIG-P	15	70	0.19	12.3
TkA02G349450	`PF08510`	PIG-P	150	162	0.19	12.3
TkA02G349450	`PF04235`	DUF418	153	176	0.041	14.5
TkA02G349450	`PF04235`	DUF418	373	408	0.041	14.5
TkA02G349450	`PF08510`	PIG-P	401	460	0.19	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22815`	Arabidopsis thaliana	sp\|O22815\|MLO5_ARATH MLO-like protein 5	54.400%	Swiss-Prot	High
`Q94KB4`	Arabidopsis thaliana	sp\|Q94KB4\|MLO9_ARATH MLO-like protein 9	55.300%	Swiss-Prot	High
`O22757`	Arabidopsis thaliana	sp\|O22757\|MLO8_ARATH MLO-like protein 8	55.000%	Swiss-Prot	High
`Q9FKY5`	Arabidopsis thaliana	sp\|Q9FKY5\|MLO10_ARATH MLO-like protein 10	49.900%	Swiss-Prot	Medium
`O22752`	Arabidopsis thaliana	sp\|O22752\|MLO7_ARATH MLO-like protein 7	51.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card