Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1377 bp · TkA02G348900|TK1151|cDNA
ATGGAGGATCTTGACCTTCCAGATTTTGAAGTTGTGGACAAGGGAGTTGAGGTGCTGGAAAAAGACGCGACAGAAGAGACACAATCGGAAGATTATAATTCAGACAAAAGATCTGTGTCAAGTGACGTCGTGAAGGAAGTCGTCCAAGATCAAGCTCATCAAAACCGATTATCTGAACTCGATTTAATCGCACAACAAATCAAAGCTCTTGAATCGATGATGAAGGAGGAAAAGAACGACGATTATGATGAAGAAACAGA...
1377 bp · TkA02G348900|TK1151|CDS
ATGGAGGATCTTGACCTTCCAGATTTTGAAGTTGTGGACAAGGGAGTTGAGGTGCTGGAAAAAGACGCGACAGAAGAGACACAATCGGAAGATTATAATTCAGACAAAAGATCTGTGTCAAGTGACGTCGTGAAGGAAGTCGTCCAAGATCAAGCTCATCAAAACCGATTATCTGAACTCGATTTAATCGCACAACAAATCAAAGCTCTTGAATCGATGATGAAGGAGGAAAAGAACGACGATTATGATGAAGAAACAGA...
Protein
Download Protein FASTA458 aa · TkA02G348900|TK1151|PROTEIN
MEDLDLPDFEVVDKGVEVLEKDATEETQSEDYNSDKRSVSSDVVKEVVQDQAHQNRLSELDLIAQQIKALESMMKEEKNDDYDEETESQRLDENEDKVTREFFQMLENEDGKEATFEHDAHSKSTFDGEDEKVYIPDLGKGLSCVIQTRNNGYLVAMNPFDNLTGKKDTPKLAMQISRPMVLDSKLTGTELFQEMAAIGFEELSSEILSLMPIEEVAGKTAEQIAFEGIASAIISGRNKEGATSSATRAIATVKSMVTGM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G348900 |
|---|---|
| TK1151 ID | TkA02G348900 |
| OH-1004 ID | LXL04_015281 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 93.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 55.491Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G348900 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:88691927-88693369 (-) | |||||||||
| Description | Similar to PMI1: Protein PLASTID MOVEMENT IMPAIRED 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006970 response to osmotic stress Biological Process GO:0009637 response to blue light Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process GO:0009902 chloroplast relocation Biological Process GO:0009903 chloroplast avoidance movement Biological Process GO:0010029 regulation of seed germination Biological Process GO:0030048 actin filament-based movement Biological Process GO:0031022 nuclear migration along microfilament Biological Process GO:1902265 abscisic acid homeostasis Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G42550 ath:AT5G20610 ath:AT5G26160 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF18502Mrpl_C53-101 aaPF21745PMI1_PMIR1-2_C62-79 aaPF21745PMI1_PMIR1-2_C171-318 aaPF21745PMI1_PMIR1-2_C377-394 aaPF14449PT-TG399-429 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G348900 | PF18502 | Mrpl_C | 53 | 101 | 0.15 | 13.1 |
| TkA02G348900 | PF21745 | PMI1_PMIR1-2_C | 62 | 79 | 3.3e-51 | 174.5 |
| TkA02G348900 | PF21745 | PMI1_PMIR1-2_C | 171 | 318 | 3.3e-51 | 174.5 |
| TkA02G348900 | PF21745 | PMI1_PMIR1-2_C | 377 | 394 | 3.3e-51 | 174.5 |
| TkA02G348900 | PF14449 | PT-TG | 399 | 429 | 0.063 | 14.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.