TkA02G348490 | RubberDandelionOmics

Gene overview

TkA02G348490

Reference: TK1151 Chr: Chr02 Coordinates: 88568632-88570819 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1277 bp · TkA02G348490|TK1151|cDNA

CAAAAAACCACCCTATATAAACCTCCATGCATCCCTCATCTTCTTCATTCAATCTCTCTCATTTCACTCACAACACACCAAAATGACAGTTTCCTCTTCATCCCTTTTCTTCTTTTTCCTTCCCCTTTTCGCCCTTTCAGCTTTTGCCCGCGAATTCTCAATTGTGGGGTACACCCCCGAAGATTTAACATGCATTGACAAAGTCATCAACCTCTTCGAATCATGGCTCTCAAAACACGAAAAGTTTTATGAGAGCATGG...

CDS

Download CDS FASTA

1050 bp · TkA02G348490|TK1151|CDS

ATGACAGTTTCCTCTTCATCCCTTTTCTTCTTTTTCCTTCCCCTTTTCGCCCTTTCAGCTTTTGCCCGCGAATTCTCAATTGTGGGGTACACCCCCGAAGATTTAACATGCATTGACAAAGTCATCAACCTCTTCGAATCATGGCTCTCAAAACACGAAAAGTTTTATGAGAGCATGGAAGAAAAGCTACATAGATTTGAGATCTTTAAGGACAACTTAAAGCATATTGATGAAACCAACAAGAAAGTTAGCAACTATTG...

Protein

Download Protein FASTA

349 aa · TkA02G348490|TK1151|PROTEIN

MTVSSSSLFFFFLPLFALSAFAREFSIVGYTPEDLTCIDKVINLFESWLSKHEKFYESMEEKLHRFEIFKDNLKHIDETNKKVSNYWLGLNEFADLSHEEFKNMFLGLKGELPERREQSPKDFTYQDFVDLPKSVDWRKKGAVSPVKNQGSCGSCWAFSTVAAVEGINQIVSGNLTVLSEQELIDCDTSFNNGCNGGLMDYAFSFIVKNGGLHKEEEYPYIMSEGTCDEKKDVSEKVTISGYHDVPRNNADSFLKALANQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G348490`
TK1151 ID	TkA02G348490
OH-1004 ID	LXL04_015288
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G348490

Location Chr02:88568632-88570819 (+)

Description Similar to XCP1: Cysteine protease XCP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20850`	Cysteine protease involved in xylem tracheary element (TE) autolysis during xylogenesis in roots.	Cysteine proteases XCP1 and XCP2 aid micro-autolysis within the intact central vacuole during xylogenesis in Arabidopsis roots.2008 · DOI: 10.1111/j.1365-313x.2008.03592.x PIRIN2 stabilizes cysteine protease XCP2 and increases susceptibility to the vascular pathogen Ralstonia solanacearum in Arabidopsis.2014 · DOI: 10.1111/tpj.12602
`At4g35350`	Cysteine protease involved in xylem tracheary element (TE) autolysis during xylogenesis in roots.	Cysteine proteases XCP1 and XCP2 aid micro-autolysis within the intact central vacuole during xylogenesis in Arabidopsis roots.2008 · DOI: 10.1111/j.1365-313x.2008.03592.x
`At5g43060`	Probable thiol protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015288 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010623 programmed cell death involved in cell development Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0140447 cytokine precursor processing Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000932 P-body Cellular Component

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ag:CAA66378

ath:AT1G20850

ath:AT1G47128

ath:AT4G35350

ath:AT5G43060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.666

Rank 1 · TkA02G348490 · TK1151

Cytoplasm0.174

Rank 2 · TkA02G348490 · TK1151

Extracellular0.144

Rank 3 · TkA02G348490 · TK1151

Endoplasmic reticulum0.136

Rank 4 · TkA02G348490 · TK1151

Cell membrane0.091

Rank 5 · TkA02G348490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05428CRF-BP_N30-74 aa

PF15960DUF476335-75 aa

PF28470PIK3AP1_C38-76 aa

PF10368YkyA38-95 aa

PF08246Inhibitor_I2945-101 aa

PF14945LLC161-122 aa

PF00112Peptidase_C1131-346 aa

PF03051Peptidase_C1_2144-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G348490	`PF05428`	CRF-BP_N	30	74	0.11	13.0
TkA02G348490	`PF15960`	DUF4763	35	75	0.014	15.3
TkA02G348490	`PF28470`	PIK3AP1_C	38	76	0.036	14.7
TkA02G348490	`PF10368`	YkyA	38	95	0.053	14.0
TkA02G348490	`PF08246`	Inhibitor_I29	45	101	4.8e-19	69.1
TkA02G348490	`PF14945`	LLC1	61	122	0.1	14.0
TkA02G348490	`PF00112`	Peptidase_C1	131	346	2e-82	277.3
TkA02G348490	`PF03051`	Peptidase_C1_2	144	163	0.0007	19.2
TkA02G348490	`PF28470`	PIK3AP1_C	179	192	0.036	14.7
TkA02G348490	`PF05428`	CRF-BP_N	263	292	0.11	13.0
TkA02G348490	`PF03051`	Peptidase_C1_2	306	328	0.0007	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LM66`	Arabidopsis thaliana	sp\|Q9LM66\|XCP2_ARATH Cysteine protease XCP2	73.700%	Swiss-Prot	High
`O65493`	Arabidopsis thaliana	sp\|O65493\|XCP1_ARATH Cysteine protease XCP1	70.300%	Swiss-Prot	High
`Q9FMH8`	Arabidopsis thaliana	sp\|Q9FMH8\|RD21B_ARATH Probable cysteine protease RD21B	56.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card