TkA02G348300 | RubberDandelionOmics

Gene overview

TkA02G348300

Reference: TK1151 Chr: Chr02 Coordinates: 88492332-88499304 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2663 bp · TkA02G348300|TK1151|cDNA

ATTTTTTGGTTGCCGGTTGTAGACACCCGGCTCTGTTTTGGCGAGCGTTTTTTTGTTCAGCTTATTGTTTGTTTTTCTTTGGCTAAGAGTGGCTTGGCTTACAAAGCTTGGTTGTTTACCTACAGCTGTAGGTTATTGGAAGGACAGTTGTCCTTGGTTTCCCCTTTCTACTCATATAAATTGGATATGAGGGCATTGATTGCTCCGTCATACCTGTATTAATTATCTCCCATGCCAAACTATATTTGTTTGATCTCTGC...

CDS

Download CDS FASTA

603 bp · TkA02G348300|TK1151|CDS

ATGAGAAACTTGTTCTATGCTGCTGTTGGTAGAACTGCTTTCAATAGTGAAGGACAAGAACGCTTGCATCATTTCTGGGAAATGGTGGCATATATTGCCAATACTCTTATTTTCATCTTGAGTGGAGTCATCATAGCTGAAGGTATACACGCAGGTGACACCATTCTTAAACAAGAAGGAAATTGTTGGGGGTACCTGATGCTCCTGTATGTTTTTGTACAACTGTCACGAGCTATAGTTGTTGGATCATTATATCCCTT...

Protein

Download Protein FASTA

200 aa · TkA02G348300|TK1151|PROTEIN

MRNLFYAAVGRTAFNSEGQERLHHFWEMVAYIANTLIFILSGVIIAEGIHAGDTILKQEGNCWGYLMLLYVFVQLSRAIVVGSLYPFLCYFGYGLDWKEALVLTWSGLRGAVALALSLLVKQSSDTSAFINQETGTLFVFLTGGIVFLTLVVNGATTQFILQILEMNKMSAAKELAHLHHSIQSDLKKLVRNPPLVTIPR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G348300`
TK1151 ID	TkA02G348300
OH-1004 ID	LXL04_015295
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.100
Protein coverage (%)	TK1151 14.000 / OH-1004 6.983 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G348300

Location Chr02:88492332-88499304 (+)

Description Similar to NHX7: Sodium/hydrogen exchanger 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01980`	Acts in electroneutral exchange of protons for cations such as Na⁺ or Li⁺ across plasma membrane.	The Arabidopsis thaliana salt tolerance gene SOS1 encodes a putative Na+/H+ antiporter.2000 · DOI: 10.1073/pnas.120170197 The putative plasma membrane Na(+)/H(+) antiporter SOS1 controls long-distance Na(+) transport in plants.2002 · DOI: 10.1105/tpc.010371 Regulation of SOS1, a plasma membrane Na+/H+ exchanger in Arabidopsis thaliana, by SOS2 and SOS3.2002 · DOI: 10.1073/pnas.122224699 SOS1, a Genetic Locus Essential for Salt Tolerance and Potassium Acquisition.1996 · DOI: 10.1105/tpc.8.4.617 Overexpression of a plasma membrane Na+/H+ antiporter gene improves salt tolerance in Arabidopsis thaliana.2003 · DOI: 10.1038/nbt766 Na+/H+ exchange activity in the plasma membrane of Arabidopsis.2003 · DOI: 10.1104/pp.102.010421
`At1g14660`	May act in low affinity electroneutral exchange of protons for cations such as Na(+) or K(+) across membranes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015295 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0007338 single fertilization Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010352 lithium ion export across the plasma membrane Biological Process

GO:0030154 cell differentiation Biological Process

GO:0030317 flagellated sperm motility Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0051453 regulation of intracellular pH Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

KEGG gene cross-reference

ath:AT1G14660

ath:AT2G01980

mmu:208169

spu:754777

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.353

Rank 1 · TkA02G348300 · TK1151

Lysosome / Vacuole0.236

Rank 2 · TkA02G348300 · TK1151

Endoplasmic reticulum0.203

Rank 3 · TkA02G348300 · TK1151

Cytoplasm0.159

Rank 4 · TkA02G348300 · TK1151

Golgi apparatus0.116

Rank 5 · TkA02G348300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09364XFP_N19-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G348300	`PF09364`	XFP_N	19	65	0.29	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LKW9`	Arabidopsis thaliana	sp\|Q9LKW9\|NHX7_ARATH Sodium/hydrogen exchanger 7	69.000%	Swiss-Prot	High
`Q3YL57`	Arabidopsis thaliana	sp\|Q3YL57\|NHX8_ARATH Sodium/hydrogen exchanger 8	62.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card