TkA02G347200 | RubberDandelionOmics

Gene overview

TkA02G347200

Reference: TK1151 Chr: Chr02 Coordinates: 88213859-88215423 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1384 bp · TkA02G347200|TK1151|cDNA

GAATAATAAGTTAAGGCCTTAAGGGTGCTTGAACTTTTCTCTAGAAGGAACTAGAACAACTTATTATGCTTTTTATTCAATGACTTTATTCCTCGTCTTCAATCTTCAATCCTTCTGGTGCCTGTGGATCTGTACAGCTGCTTCATACGATACTTTTCTGGTGCAGAAAGAAGATGTCGAGGAGAAACACCAGAGGCCCCTCGAACGGGATGATCCCCTTGATGTTATTGCAGGCCGTTAACGAGTACCGGAGGCTTGAA...

CDS

Download CDS FASTA

996 bp · TkA02G347200|TK1151|CDS

ATGTCGAGGAGAAACACCAGAGGCCCCTCGAACGGGATGATCCCCTTGATGTTATTGCAGGCCGTTAACGAGTACCGGAGGCTTGAACGTAAACCCCCCGTCACGGCGGCTATTCTTGCTGCCAACACTCTCATTTATCTACGCCCTGCCTTCCTTGATCACATCCTTCCTACAATTGACGATGTCTGGTTCAATGCTCATCTCATCGTTAAGGATAAGGACCTGAAGCGCTTCTTCTTATCTGCTTTCTATCATCTCGG...

Protein

Download Protein FASTA

331 aa · TkA02G347200|TK1151|PROTEIN

MSRRNTRGPSNGMIPLMLLQAVNEYRRLERKPPVTAAILAANTLIYLRPAFLDHILPTIDDVWFNAHLIVKDKDLKRFFLSAFYHLGESHLVYNMISLLWKGIQLETSLGSAEFASMVAALLGLSQGITLVLAKSLLLFNYERAYYNEYAAGFSGVLFAMKVVLNSQSDGYTNLNGFVVPAKHADWAELVLIQLLVPNVSFLGHLGGILAGIVYLRLKASYTGPSPLTKMVKALTSLLGWPLRSLLRIWQPQQQRFSGRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G347200`
TK1151 ID	TkA02G347200
OH-1004 ID	LXL04_015316
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G347200

Location Chr02:88213859-88215423 (-)

Description Similar to RBL14: Rhomboid-like protein 14, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17611`	Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015316 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0010954 positive regulation of protein processing Biological Process

GO:0031293 membrane protein intracellular domain proteolysis Biological Process

GO:0033619 membrane protein proteolysis Biological Process

GO:0034620 cellular response to unfolded protein Biological Process

GO:0034644 cellular response to UV Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0045732 positive regulation of protein catabolic process Biological Process

GO:0048515 spermatid differentiation Biological Process

GO:0051047 positive regulation of secretion Biological Process

GO:1904211 membrane protein proteolysis involved in retrograde protein transport, ER to cytosol Biological Process

KEGG gene cross-reference

ath:AT3G17611

hsa:84236

mmu:76867

pon:100172352

rno:316557

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.525

Rank 1 · TkA02G347200 · TK1151

Golgi apparatus0.330

Rank 2 · TkA02G347200 · TK1151

Cytoplasm0.112

Rank 3 · TkA02G347200 · TK1151

Nucleus0.107

Rank 4 · TkA02G347200 · TK1151

Cell membrane0.068

Rank 5 · TkA02G347200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01694Rhomboid19-50 aa

PF08551DUF175173-216 aa

PF01694Rhomboid74-216 aa

PF10658DUF2484179-219 aa

PF10658DUF2484223-247 aa

PF00641Zn_ribbon_RanBP276-299 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G347200	`PF01694`	Rhomboid	19	50	1.4e-21	77.9
TkA02G347200	`PF08551`	DUF1751	73	216	0.022	14.8
TkA02G347200	`PF01694`	Rhomboid	74	216	1.4e-21	77.9
TkA02G347200	`PF10658`	DUF2484	179	219	2.2	9.3
TkA02G347200	`PF10658`	DUF2484	223	247	2.2	9.3
TkA02G347200	`PF00641`	Zn_ribbon_RanBP	276	299	3.3e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXW0`	Arabidopsis thaliana	sp\|Q8RXW0\|RBL14_ARATH Rhomboid-like protein 14, mitochondrial	61.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card