TkA02G347020 | RubberDandelionOmics

Gene overview

TkA02G347020

Reference: TK1151 Chr: Chr02 Coordinates: 88160245-88161556 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1170 bp · TkA02G347020|TK1151|cDNA

ATGTTCACCGTCAAGCACTTCAAAGTCCTCCCTTCTACGCCACCTTATTTGTTGCGTCAAAAATTCTATTCAATCTCAGAATCCCCGTCCACGTCTTCTTCTACGTTTCGCTTTTTAGGTTCGTTATTTGGGTCTTTTTCTTTAAAACCGATTGATATCACAACTTGTAGTAGTATCAAACTATCAATGGAGGTCGCCGGCGTTGCACTTCGTCAAGCTCCGTGCTTCTCTTCGAGCGGCGCTGATGCCTTCAACTCCCG...

CDS

Download CDS FASTA

1170 bp · TkA02G347020|TK1151|CDS

ATGTTCACCGTCAAGCACTTCAAAGTCCTCCCTTCTACGCCACCTTATTTGTTGCGTCAAAAATTCTATTCAATCTCAGAATCCCCGTCCACGTCTTCTTCTACGTTTCGCTTTTTAGGTTCGTTATTTGGGTCTTTTTCTTTAAAACCGATTGATATCACAACTTGTAGTAGTATCAAACTATCAATGGAGGTCGCCGGCGTTGCACTTCGTCAAGCTCCGTGCTTCTCTTCGAGCGGCGCTGATGCCTTCAACTCCCG...

Protein

Download Protein FASTA

389 aa · TkA02G347020|TK1151|PROTEIN

MFTVKHFKVLPSTPPYLLRQKFYSISESPSTSSSTFRFLGSLFGSFSLKPIDITTCSSIKLSMEVAGVALRQAPCFSSSGADAFNSRHLSSFPTVKSSRSFCLKQTRSVKSLVASVGFDEFSDKSHLQYYNGPKMAVKEKEVAAKKKDMKKKLKLLKGLSKNLSIFSDIGFGLNPADGLDHQVKGQMISEATEVLLGQLQKLKAEEMESKKMKKEEKAKKKAAKLMMVCNESSSSSSESSCSSESDCENIVDMKQLKTVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G347020`
TK1151 ID	TkA02G347020
OH-1004 ID	LXL04_015321
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 95.630 / OH-1004 65.841 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G347020

Location Chr02:88160245-88161556 (+)

Description Similar to DGAT3: Diacylglycerol O-acyltransferase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48300`	Involved in triacylglycerol (TAG) biosynthesis.	A cytosolic acyltransferase contributes to triacylglycerol synthesis in sucrose-rescued Arabidopsis seed oil catabolism mutants.2012 · DOI: 10.1104/pp.112.201541 Arabidopsis thaliana DGAT3 is a [2Fe-2S] protein involved in TAG biosynthesis.2018 · DOI: 10.1038/s41598-018-35545-7

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015321 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006071 glycerol metabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004144 diacylglycerol O-acyltransferase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051536 iron-sulfur cluster binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT1G48300

gmx:100776407

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.812

Rank 1 · TkA02G347020 · TK1151

Nucleus0.189

Rank 2 · TkA02G347020 · TK1151

Mitochondrion0.064

Rank 3 · TkA02G347020 · TK1151

Cytoplasm0.041

Rank 4 · TkA02G347020 · TK1151

Cell membrane0.024

Rank 5 · TkA02G347020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12467CMV_1a23-35 aa

PF28697DGAT3_N140-221 aa

PF12467CMV_1a179-247 aa

PF012572Fe-2S_thioredx292-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G347020	`PF12467`	CMV_1a	23	35	0.096	13.6
TkA02G347020	`PF28697`	DGAT3_N	140	221	3e-28	98.8
TkA02G347020	`PF12467`	CMV_1a	179	247	0.096	13.6
TkA02G347020	`PF01257`	2Fe-2S_thioredx	292	344	0.00021	21.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5W0`	Arabidopsis thaliana	sp\|Q9C5W0\|DGAT3_ARATH Diacylglycerol O-acyltransferase 3	38.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card