TkA02G342510 | RubberDandelionOmics

Gene overview

TkA02G342510

Reference: TK1151 Chr: Chr02 Coordinates: 86971304-86973612 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · TkA02G342510|TK1151|cDNA

ATGGAGTCTCTGGTTCTATCATCATCATCTTCTTCATCTTCGTATTCTTCATTTGGTTGCTTTCTGGAGACAAAGCACAACTTAAATTCACATTTAAGAAATGGATTCGCTTTATCTTCCCCCTTTCCTTCACAAAATTCGCCTTTCAGCGTCAGAAAGTCACTTGTTATGGCCGCCAAGAAAAATCACAATTCCGACAAGAAGAAACAAGATAGACATAGCTTCGTAGCCAAACCAGATGAAACCACTGGTCTTTTCCC...

CDS

Download CDS FASTA

1131 bp · TkA02G342510|TK1151|CDS

ATGGAGTCTCTGGTTCTATCATCATCATCTTCTTCATCTTCGTATTCTTCATTTGGTTGCTTTCTGGAGACAAAGCACAACTTAAATTCACATTTAAGAAATGGATTCGCTTTATCTTCCCCCTTTCCTTCACAAAATTCGCCTTTCAGCGTCAGAAAGTCACTTGTTATGGCCGCCAAGAAAAATCACAATTCCGACAAGAAGAAACAAGATAGACATAGCTTCGTAGCCAAACCAGATGAAACCACTGGTCTTTTCCC...

Protein

Download Protein FASTA

376 aa · TkA02G342510|TK1151|PROTEIN

MESLVLSSSSSSSSYSSFGCFLETKHNLNSHLRNGFALSSPFPSQNSPFSVRKSLVMAAKKNHNSDKKKQDRHSFVAKPDETTGLFPESVLLKQKVVQEDGKLLPEFADAEEQELYEALNLMLESDLDAEQNRHYEVVYLIHENFEEEVEKVNLNIQEFLTEKKGRVHRFSDWGLRRLAYKIQKAKNAHYILMNFEIEAKWINEFKTMLDKDERIIRHLVMKQDEAITEECVPPPEFHTLRADMDDNDDDDDDDDDEDED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G342510`
TK1151 ID	TkA02G342510
OH-1004 ID	LXL04_006428
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	76.500
Protein coverage (%)	TK1151 9.043 / OH-1004 4.823 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G342510

Location Chr02:86971304-86973612 (-)

Description Similar to AtMg00810: Uncharacterized mitochondrial protein AtMg00810

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17170`	Prevents non-specific action of the splicing factor CFM3b during plastid rRNA biogenesis to improve the accuracy of plastid rRNA processing.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006428 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.954

Rank 1 · TkA02G342510 · TK1151

Mitochondrion0.041

Rank 2 · TkA02G342510 · TK1151

Nucleus0.040

Rank 3 · TkA02G342510 · TK1151

Cytoplasm0.022

Rank 4 · TkA02G342510 · TK1151

Cell membrane0.015

Rank 5 · TkA02G342510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05642Sporozoite_P6710-97 aa

PF04931DNA_pol_phi62-147 aa

PF05285SDA1_dom62-73 aa

PF01250Ribosomal_S6134-222 aa

PF04931DNA_pol_phi214-289 aa

PF15713PTPRCAP237-287 aa

PF05642Sporozoite_P67241-295 aa

PF05285SDA1_dom241-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G342510	`PF05642`	Sporozoite_P67	10	97	2.7	6.7
TkA02G342510	`PF04931`	DNA_pol_phi	62	147	1.9	7.2
TkA02G342510	`PF05285`	SDA1_dom	62	73	3.2	8.9
TkA02G342510	`PF01250`	Ribosomal_S6	134	222	1.8e-25	89.6
TkA02G342510	`PF04931`	DNA_pol_phi	214	289	1.9	7.2
TkA02G342510	`PF15713`	PTPRCAP	237	287	0.061	14.5
TkA02G342510	`PF05642`	Sporozoite_P67	241	295	2.7	6.7
TkA02G342510	`PF05285`	SDA1_dom	241	289	3.2	8.9
TkA02G342510	`PF04147`	Nop14	243	321	0.0018	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q948R9`	Arabidopsis thaliana	sp\|Q948R9\|RFAC3_ARATH Protein REGULATOR OF FATTY ACID COMPOSITION 3, chloroplastic	71.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card