TkA02G341460 | RubberDandelionOmics

Gene overview

TkA02G341460

Reference: TK1151 Chr: Chr02 Coordinates: 86738125-86743102 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1702 bp · TkA02G341460|TK1151|cDNA

AAGCTGCTTCACCGACCTTGCATCCCAAACCAGCGATTTCCGTTTTCTCCACAGACTTCTCCACCGGCGAGCTTCAATTTCAACTACTACGCTGTGTTTTCTCAGGAATTGGCTGGTTTGAGCGTTGCTACAGCAATTGCCGAGGTATACAATGTGAAGGATTACAATCGTGTATTGGCCATATGTGGCCCAGGCAACAATGGTGGTGATGGTCTTGTAGTTGCTCGTCATTTGTATCACTTTGGATATAAACCATCTGT...

CDS

Download CDS FASTA

1479 bp · TkA02G341460|TK1151|CDS

ATGGCTAGCAACATCAAAGTGGTTCAAAATCCCGACTCAATTTCGTATTTGAATCAACGAGAAGCAGCTGAAATTGATGAGATTCTAATGGGTCCTCTTGGATTTAGCGTCGACCAGCTCATGGAATTGGCTGGTTTGAGCGTTGCTACAGCAATTGCCGAGGTATACAATGTGAAGGATTACAATCGTGTATTGGCCATATGTGGCCCAGGCAACAATGGTGGTGATGGTCTTGTAGTTGCTCGTCATTTGTATCACTT...

Protein

Download Protein FASTA

492 aa · TkA02G341460|TK1151|PROTEIN

MASNIKVVQNPDSISYLNQREAAEIDEILMGPLGFSVDQLMELAGLSVATAIAEVYNVKDYNRVLAICGPGNNGGDGLVVARHLYHFGYKPSVCYPKRTAKPLYTGLVTQLESLGIPFLSVDDLPMNLSEDFNILVDAMFGFSFYGTPRPPFDDLIKRLVNLQSYNEINKKPSVIASIDIPSGWHVEQGDTSGDGIKPDMLVSLTAPKQCAKNFSGSHHFLGGRFVPPSIVDKFKLELPSYPGSSMCVRIGKAPQVDISS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G341460`
TK1151 ID	TkA02G341460
OH-1004 ID	LXL04_031126
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.500
Protein coverage (%)	TK1151 100.000 / OH-1004 82.199 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G341460

Location Chr02:86738125-86743102 (-)

Description Similar to PPOX1: Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49970`	Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP).	Identification of a pyridoxine (pyridoxamine) 5'-phosphate oxidase from Arabidopsis thaliana.2007 · DOI: 10.1016/j.febslet.2006.12.028 Vitamer levels, stress response, enzyme activity, and gene regulation of Arabidopsis lines mutant in the pyridoxine/pyridoxamine 5'-phosphate oxidase (PDX3) and the pyridoxal kinase (SOS4) genes involved in the vitamin B6 salvage pathway.2007 · DOI: 10.1104/pp.107.105189

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031126 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006739 NADP+ metabolic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0008615 pyridoxine biosynthetic process Biological Process

GO:0010874 regulation of cholesterol efflux Biological Process

GO:0019674 NAD+ metabolic process Biological Process

GO:0031580 membrane raft distribution Biological Process

GO:0046496 nicotinamide nucleotide metabolic process Biological Process

GO:0110051 metabolite repair Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

amr:AM1_4597

ath:AT5G49970

mmu:246703

rno:295229

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.732

Rank 1 · TkA02G341460 · TK1151

Nucleus0.387

Rank 2 · TkA02G341460 · TK1151

Mitochondrion0.086

Rank 3 · TkA02G341460 · TK1151

Peroxisome0.061

Rank 4 · TkA02G341460 · TK1151

Cell membrane0.046

Rank 5 · TkA02G341460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03853YjeF_N38-210 aa

PF12766Pyridox_oxase_2285-366 aa

PF01243PNPOx_N287-424 aa

PF16242Pyrid_ox_like295-374 aa

PF10590PNP_phzG_C448-492 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G341460	`PF03853`	YjeF_N	38	210	2.3e-36	126.0
TkA02G341460	`PF12766`	Pyridox_oxase_2	285	366	2.7e-05	25.4
TkA02G341460	`PF01243`	PNPOx_N	287	424	7e-26	91.7
TkA02G341460	`PF16242`	Pyrid_ox_like	295	374	0.0067	16.7
TkA02G341460	`PF10590`	PNP_phzG_C	448	492	3.7e-19	69.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTX3`	Arabidopsis thaliana	sp\|Q9LTX3\|PPOX1_ARATH Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic	71.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card