TkA02G336850 | RubberDandelionOmics

Gene overview

TkA02G336850

Reference: TK1151 Chr: Chr02 Coordinates: 85506898-85516711 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5704 bp · TkA02G336850|TK1151|cDNA

AAAGCGCATCCTTTCTTTCACTTCCTCTCCTCTTACTTTCTCTCACCGAAGGCTTCGTCTTTGTTTCTCTCTCCTCCGCCCTCTGCCTATGCGTTTTCTTTCTCTCTTCTCCCCAAAAGAAAATAAAAACATTCGTTTACAATACAAGAGGAAGCAGAGCTCCCATCATCACTCTAATTCGATTCCCCAGCTTATCATTCTGTTTCTGATTTTTTCCCCATAATATTCGAACTCCAATTCTTCTCCTGCCGATATTTTAT...

CDS

Download CDS FASTA

4812 bp · TkA02G336850|TK1151|CDS

ATGGCTCTTCACAAGAACATTCCTCCCAATGAACCGCCTAGCGGGAGTTTAAAACCGTTGACTTTTTCCGGAAAGGTCAAAGAGAGAGGTCAACTTGCTGACATGGACAAACGGGTCAATGAATCAGAAGCAGACATTGACCTCCGTGAGGTCTACTTTTTAATCATGCATTTCTTATCAGCTGGGCCATGTCACCGGACATACGGTCAGTTTTGGAATGAACTTCTTGAACATCAACTATTGCCTAGAAGATACCATGC...

Protein

Download Protein FASTA

1603 aa · TkA02G336850|TK1151|PROTEIN

MALHKNIPPNEPPSGSLKPLTFSGKVKERGQLADMDKRVNESEADIDLREVYFLIMHFLSAGPCHRTYGQFWNELLEHQLLPRRYHAWYSRTGVTSGDEDDDGTSFPLSYNKLVERYPHIEKDHLVKLLKQQLSGAASSSSSQGVITPLNAAAVPTLLGTGSFSLLSDDVKKEVKRPPGFMRWPHMQADQVRGLGLREIGGGFARHHRAPSIRAASYAIVKPSTMVQKMENLKKLRGHRNAVYCAIFDRLGRYVITGSDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G336850`
TK1151 ID	TkA02G336850
OH-1004 ID	LXL04_020148
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.800
Protein coverage (%)	TK1151 2.059 / OH-1004 32.353 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G336850`
Location	Chr02:85506898-85516711 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020148` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · TkA02G336850 · TK1151

Cytoplasm0.082

Rank 2 · TkA02G336850 · TK1151

Cell membrane0.026

Rank 3 · TkA02G336850 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA02G336850 · TK1151

Plastid0.011

Rank 5 · TkA02G336850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25437BRWD1_N37-133 aa

PF25047Beta-prop_TEP1_2nd222-330 aa

PF23409Beta-prop_EML225-302 aa

PF25175Beta-prop_WDR5226-360 aa

PF25174Beta-prop_THOC3226-334 aa

PF25173Beta-prop_WDR3_1st226-357 aa

PF24817WD40_WDHD1_1st226-276 aa

PF24807WD40_CDC20-Fz226-359 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G336850	`PF25437`	BRWD1_N	37	133	9.7e-35	119.4
TkA02G336850	`PF25047`	Beta-prop_TEP1_2nd	222	330	9.2e-19	68.3
TkA02G336850	`PF23409`	Beta-prop_EML	225	302	4.1e-09	37.0
TkA02G336850	`PF25175`	Beta-prop_WDR5	226	360	5.1e-47	161.3
TkA02G336850	`PF25174`	Beta-prop_THOC3	226	334	9.4e-47	160.0
TkA02G336850	`PF25173`	Beta-prop_WDR3_1st	226	357	6.5e-36	124.5
TkA02G336850	`PF24817`	WD40_WDHD1_1st	226	276	9.3e-28	97.9
TkA02G336850	`PF24807`	WD40_CDC20-Fz	226	359	6.9e-21	75.5
TkA02G336850	`PF24796`	WDR55	226	360	3.1e-08	33.7
TkA02G336850	`PF23381`	Beta-prop_IFT122_1st	227	310	4.5e-37	128.6
TkA02G336850	`PF24780`	WD40_MABP1-WDR62_1st	227	332	0.0013	18.8
TkA02G336850	`PF24814`	WD40_Prp19	228	313	2.8e-30	106.1
TkA02G336850	`PF24105`	Beta-prop_CAF1B_HIR1	228	394	6.6e-14	52.4
TkA02G336850	`PF23609`	Beta-prop_EIPR1	229	308	0.0049	17.1
TkA02G336850	`PF24797`	Beta-prop_WDR35_TULP_N	229	269	0.097	12.5
TkA02G336850	`PF24805`	EIF3I	230	276	5.3e-19	69.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card