TkA02G330430 | RubberDandelionOmics

Gene overview

TkA02G330430

Reference: TK1151 Chr: Chr02 Coordinates: 83816195-83816863 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · TkA02G330430|TK1151|cDNA

ATGACAAACCTAGGTTTGTTATTTAGAGAATGGCTCGAAGCGATAACTGAATATGTCGATTGGATCAATCCAATGTGTTTTGGTTATCACGGTTCTTGGGAAAATTTCACTGGATTGCATTCTGCTTTATACGACCCAAACACCAATCTCAGTACAGATTTTGGTATTGGGTCGTGGATTCGAGCAGGCATGCCACCTAACAAAATTGTCATGGGCCTACCACTCTACGGCCCCACATGGTCTCTTGCAGACCCGAATGT...

CDS

Download CDS FASTA

555 bp · TkA02G330430|TK1151|CDS

ATGACAAACCTAGGTTTGTTATTTAGAGAATGGCTCGAAGCGATAACTGAATATGTCGATTGGATCAATCCAATGTGTTTTGGTTATCACGGTTCTTGGGAAAATTTCACTGGATTGCATTCTGCTTTATACGACCCAAACACCAATCTCAGTACAGATTTTGGTATTGGGTCGTGGATTCGAGCAGGCATGCCACCTAACAAAATTGTCATGGGCCTACCACTCTACGGCCCCACATGGTCTCTTGCAGACCCGAATGT...

Protein

Download Protein FASTA

184 aa · TkA02G330430|TK1151|PROTEIN

MTNLGLLFREWLEAITEYVDWINPMCFGYHGSWENFTGLHSALYDPNTNLSTDFGIGSWIRAGMPPNKIVMGLPLYGPTWSLADPNVNTVGAQTIGTGPGSGLLVYSDVINFNEENNSTVVFDNNMVSYYSYSGDSWVSYDDVRSIELKVRYAQNRSLGGYFFWALGQDLDWTISSAASEAWLN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G330430`
TK1151 ID	TkA02G330430
OH-1004 ID	LXL04_015453
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.400
Protein coverage (%)	TK1151 100.000 / OH-1004 59.200 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G330430

Location Chr02:83816195-83816863 (+)

Description Similar to CHIT5: Class V chitinase CHIT5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19810`	Can hydrolyze glycol chitin and chitin oligosaccharides (e.g. N-acetylglucosamine) (GlcNAc)4, (GlcNAc)5 and (GlcNAc)6.	A class V chitinase from Arabidopsis thaliana: gene responses, enzymatic properties, and crystallographic analysis.2011 · DOI: 10.1007/s00425-011-1390-3 Introduction of a tryptophan side chain into subsite +1 enhances transglycosylation activity of a GH-18 chitinase from Arabidopsis thaliana, AtChiC.2013 · DOI: 10.1093/glycob/cws125

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015453 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006032 chitin catabolic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009877 nodulation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004568 chitinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G19810

mtr:25481955

mtr:25493983

mtr:25493984

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.722

Rank 1 · TkA02G330430 · TK1151

Cytoplasm0.110

Rank 2 · TkA02G330430 · TK1151

Lysosome / Vacuole0.034

Rank 3 · TkA02G330430 · TK1151

Nucleus0.032

Rank 4 · TkA02G330430 · TK1151

Plastid0.028

Rank 5 · TkA02G330430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00704Glyco_hydro_1812-169 aa

PF17780OCRE42-60 aa

PF26696PTL_trimer85-140 aa

PF17780OCRE122-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G330430	`PF00704`	Glyco_hydro_18	12	169	3.9e-39	135.9
TkA02G330430	`PF17780`	OCRE	42	60	0.034	14.9
TkA02G330430	`PF26696`	PTL_trimer	85	140	0.056	14.0
TkA02G330430	`PF17780`	OCRE	122	142	0.034	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81862`	Arabidopsis thaliana	sp\|O81862\|CHIC_ARATH Class V chitinase	40.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card