TkA02G328260 | RubberDandelionOmics

Gene overview

TkA02G328260

Reference: TK1151 Chr: Chr02 Coordinates: 83315662-83316225 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA02G328260|TK1151|cDNA

AAGAAGGAGAGACGACGGTATCCGCCTGGGATTTGCTCGTCGTTTCACGAGACTGCATCAATCGCCGTTCACAGCCCTCTGTTTGTGCTTGCAGACGCCGCCGTCGGCTATTCTAATGCTAGCTATTACACCTCTCTTGGTCTATTCGTCATCTCTGTACCAGGTCTTTGGTCCCTCATCAAGCGCTCTGTTAAATCCAAGGTGGTGAAAAAGACATTCGTAGAGGAACAGAAGGAAGGAGGGAAGAAGGCGCCTAACCA...

CDS

Download CDS FASTA

411 bp · TkA02G328260|TK1151|CDS

AAGAAGGAGAGACGACGGTATCCGCCTGGGATTTGCTCGTCGTTTCACGAGACTGCATCAATCGCCGTTCACAGCCCTCTGTTTGTGCTTGCAGACGCCGCCGTCGGCTATTCTAATGCTAGCTATTACACCTCTCTTGGTCTATTCGTCATCTCTGTACCAGGTCTTTGGTCCCTCATCAAGCGCTCTGTTAAATCCAAGGTGGTGAAAAAGACATTCGTAGAGGAACAGAAGGAAGGAGGGAAGAAGGCGCCTAACCA...

Protein

Download Protein FASTA

137 aa · TkA02G328260|TK1151|PROTEIN

KKERRRYPPGICSSFHETASIAVHSPLFVLADAAVGYSNASYYTSLGLFVISVPGLWSLIKRSVKSKVVKKTFVEEQKEGGKKAPNQLAGEILSFFTRNNFLVLDKGETITFEGTMVASRGQAVLLTFCTCISLASV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G328260`
TK1151 ID	TkA02G328260
OH-1004 ID	LXL04_008330
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.400
Protein coverage (%)	TK1151 100.000 / OH-1004 56.846 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G328260

Location Chr02:83315662-83316225 (-)

Description Similar to CCB1: Protein COFACTOR ASSEMBLY OF COMPLEX C SUBUNIT B CCB1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26710`	Required for the biogenesis and accumulation of native cytochrome b6 in the thylakoid membrane.	A novel pathway of cytochrome c biogenesis is involved in the assembly of the cytochrome b6f complex in arabidopsis chloroplasts.2008 · DOI: 10.1074/jbc.m803869200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008330 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010190 cytochrome b6f complex assembly Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT3G26710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.365

Rank 1 · TkA02G328260 · TK1151

Mitochondrion0.325

Rank 2 · TkA02G328260 · TK1151

Cytoplasm0.124

Rank 3 · TkA02G328260 · TK1151

Endoplasmic reticulum0.113

Rank 4 · TkA02G328260 · TK1151

Nucleus0.067

Rank 5 · TkA02G328260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12046CCB141-137 aa

PF16549T2SSS_257-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G328260	`PF12046`	CCB1	41	137	3.4e-24	85.8
TkA02G328260	`PF16549`	T2SSS_2	57	125	0.011	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSE4`	Arabidopsis thaliana	sp\|Q9LSE4\|CCB1_ARATH Protein COFACTOR ASSEMBLY OF COMPLEX C SUBUNIT B CCB1, chloroplastic	74.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card