TkA02G326340 | RubberDandelionOmics

Gene overview

TkA02G326340

Reference: TK1151 Chr: Chr02 Coordinates: 82788413-82792793 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2032 bp · TkA02G326340|TK1151|cDNA

CTTCAACCTGTTCGACGAAATGTCAGAACCAATAAAAACTCTATCTAATGGCCTCCGCCATTGAAACCCGGTGTCCAACCTCGCAACAAAACTCAACGGATGAACGACTGATCAATTCGGGTTGCGTTCAGAAAGAAAAACAAAAATGGGCTTCTTTACCGGTCTCTTTTTTGGTGTCGCATTTGGTCTCGGTTTCATAGTCTGCGTTGCTCGTCACCAGATCATCCGATCTGCTCGTCGTGCTGATCTGGCTGCAACCA...

CDS

Download CDS FASTA

1695 bp · TkA02G326340|TK1151|CDS

ATGGGCTTCTTTACCGGTCTCTTTTTTGGTGTCGCATTTGGTCTCGGTTTCATAGTCTGCGTTGCTCGTCACCAGATCATCCGATCTGCTCGTCGTGCTGATCTGGCTGCAACCATCGCGGCTTTTGCAAGGATGACAGTTGCGGATTCCAGAAAGCTTCTTCCAGGAGAGTATTATCCTCCATGGGTGGTTTTTTCTCAGAGACAGAAGTTAAATTGGCTTAATCTGATAATGAACAAGATCTGGCCGTATGTTGATGA...

Protein

Download Protein FASTA

564 aa · TkA02G326340|TK1151|PROTEIN

MGFFTGLFFGVAFGLGFIVCVARHQIIRSARRADLAATIAAFARMTVADSRKLLPGEYYPPWVVFSQRQKLNWLNLIMNKIWPYVDEAASDLIRSSVEPILEQYKPMILSSLKFSKLTLGTVAPQFTGVSVEEGDPGEITMEMEIQWDGNPNVILDIVTRVGVALPIQVKNIAFTGVFRLIFKPLVDEFPCFGAVLFSLREKKQLDFTLKVIGGDLSALPGVSDAIEETIKDAVEDSVTWPVRIVIPILAGDYSDLELKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G326340`
TK1151 ID	TkA02G326340
OH-1004 ID	LXL04_015486
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G326340

Location Chr02:82788413-82792793 (+)

Description Similar to SYT4: Synaptotagmin-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11100`	May be involved in membrane trafficking.	No verified direct reference in this release
`At1g05500`	May be involved in membrane trafficking.	No verified direct reference in this release
`At3g61050`	May be involved in membrane trafficking (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015486 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006869 lipid transport Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0033011 perinuclear theca Cellular Component

KEGG gene cross-reference

ath:AT1G05500

ath:AT3G61050

ath:AT5G11100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.584

Rank 1 · TkA02G326340 · TK1151

Cytoplasm0.298

Rank 2 · TkA02G326340 · TK1151

Endoplasmic reticulum0.162

Rank 3 · TkA02G326340 · TK1151

Golgi apparatus0.130

Rank 4 · TkA02G326340 · TK1151

Nucleus0.106

Rank 5 · TkA02G326340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05440MtrB2-21 aa

PF17047SMP_LBD70-248 aa

PF25669SMP_MUG190-like72-130 aa

PF05440MtrB74-105 aa

PF26547PDZD8_N106-241 aa

PF25669SMP_MUG190-like157-238 aa

PF00168C2262-366 aa

PF14217DUF4327270-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G326340	`PF05440`	MtrB	2	21	3.0	9.0
TkA02G326340	`PF17047`	SMP_LBD	70	248	1.2e-14	54.9
TkA02G326340	`PF25669`	SMP_MUG190-like	72	130	8e-09	36.0
TkA02G326340	`PF05440`	MtrB	74	105	3.0	9.0
TkA02G326340	`PF26547`	PDZD8_N	106	241	0.00026	21.5
TkA02G326340	`PF25669`	SMP_MUG190-like	157	238	8e-09	36.0
TkA02G326340	`PF00168`	C2	262	366	1e-55	187.1
TkA02G326340	`PF14217`	DUF4327	270	289	0.04	14.8
TkA02G326340	`PF00168`	C2	440	542	1e-55	187.1
TkA02G326340	`PF14217`	DUF4327	492	513	0.04	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0JJX5`	Arabidopsis thaliana	sp\|A0JJX5\|SYT4_ARATH Synaptotagmin-4	69.900%	Swiss-Prot	High
`Q8L706`	Arabidopsis thaliana	sp\|Q8L706\|SYT5_ARATH Synaptotagmin-5	66.700%	Swiss-Prot	High
`Q9LEX1`	Arabidopsis thaliana	sp\|Q9LEX1\|CLB_ARATH Calcium-dependent lipid-binding protein	38.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card