TkA02G325470 | RubberDandelionOmics

Gene overview

TkA02G325470

Reference: TK1151 Chr: Chr02 Coordinates: 82573765-82576968 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1374 bp · TkA02G325470|TK1151|cDNA

ATTCGGTCAACGCATTGAAAGGAAAAAAAGTTGAAAAAAATGAAAGGAATCGGTGCCAAAAAGTAGAAAACGGAGGGCACTCCTCAACGGTCTTTGAACCCCCATCGATCCCTCAGCCGAGAGGCAACTAATCGGAGGTTTTGTGATAATTGATCTCTGATTATGATGCCATCAAGCGACCGTATGAGCTTACCGGTGTCGGATCCTCCTCCTCAGCAAAAAGGCGGCGCCGGCGAACAGAGGCTCTTTAAAGGATCCAC...

CDS

Download CDS FASTA

1038 bp · TkA02G325470|TK1151|CDS

ATGATGCCATCAAGCGACCGTATGAGCTTACCGGTGTCGGATCCTCCTCCTCAGCAAAAAGGCGGCGCCGGCGAACAGAGGCTCTTTAAAGGATCCACTATGACCTCTCGCGGTGCTTATGCTGCCGTCTCTTACATGTCTTGCGCTGTGATGCTGGTATTGTTTAACAAAGCAGCTCTTTCCTCATATAGTTTTCCATCTGCAAATGTCATCACTCTATTTCAGATGATATGTTCATGTTCATTTCTTTACTTTTTACG...

Protein

Download Protein FASTA

345 aa · TkA02G325470|TK1151|PROTEIN

MMPSSDRMSLPVSDPPPQQKGGAGEQRLFKGSTMTSRGAYAAVSYMSCAVMLVLFNKAALSSYSFPSANVITLFQMICSCSFLYFLRRWKIISFSSSDTSSSLTDNSSRFVSLQTLIQTSPLALTYLLYMLATMESVRGVNVPMYTTLRRTTVVFTMFVEFILVGQKYSRSVIGSVGLIVFGAFVAGSRDLSFEAYGYGIVFLSNITTAIYLATISRIGKSSGLNSFGLMWCNGILCGPILLFWTFIRGDLRMTLDFPYL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G325470`
TK1151 ID	TkA02G325470
OH-1004 ID	LXL04_015506
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G325470

Location Chr02:82573765-82576968 (+)

Description Similar to UGNT1: UDP-N-acetylglucosamine transporter UGNT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32272`	Mediates the transport of UDP-N-acetylglucosamine (UDP- GlcNAc) across the Golgi apparatus membrane.	A Golgi UDP-GlcNAc transporter delivers substrates for N-linked glycans and sphingolipids.2018 · DOI: 10.1038/s41477-018-0235-5

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015506 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006491 N-glycan processing Biological Process

GO:0015012 heparan sulfate proteoglycan biosynthetic process Biological Process

GO:0015780 nucleotide-sugar transmembrane transport Biological Process

GO:0030148 sphingolipid biosynthetic process Biological Process

GO:0036066 protein O-linked glycosylation via fucose Biological Process

GO:0050650 chondroitin sulfate proteoglycan biosynthetic process Biological Process

GO:0090481 pyrimidine nucleotide-sugar transmembrane transport Biological Process

GO:1990569 UDP-N-acetylglucosamine transmembrane transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT4G32272

bta:613734

hsa:23169

mmu:242585

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.632

Rank 1 · TkA02G325470 · TK1151

Endoplasmic reticulum0.223

Rank 2 · TkA02G325470 · TK1151

Cytoplasm0.089

Rank 3 · TkA02G325470 · TK1151

Lysosome / Vacuole0.055

Rank 4 · TkA02G325470 · TK1151

Cell membrane0.042

Rank 5 · TkA02G325470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA38-185 aa

PF03151TPT48-337 aa

PF08449UAA65-340 aa

PF00892EamA197-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G325470	`PF00892`	EamA	38	185	3.5e-05	24.8
TkA02G325470	`PF03151`	TPT	48	337	1e-10	42.2
TkA02G325470	`PF08449`	UAA	65	340	2.5e-05	24.3
TkA02G325470	`PF00892`	EamA	197	336	3.5e-05	24.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A8MRY9`	Arabidopsis thaliana	sp\|A8MRY9\|UGNT1_ARATH UDP-N-acetylglucosamine transporter UGNT1	71.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card