TkA02G320530 | RubberDandelionOmics

Gene overview

TkA02G320530

Reference: TK1151 Chr: Chr02 Coordinates: 81417217-81419218 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · TkA02G320530|TK1151|cDNA

ATGGAGTCGAAGTTCTGTACATTCATCTGCAGCGTTGAATCTAAACTCCAAATTCGAATCCGAAGCGGCGGCCATGATGACGAAGGCCTTTCCTACACCTCCCATGATCACACCCCTTTCATCCTTCTTGACATGAGCAAACTCCGTAATAATCTTGGATTCCCGGCGGGAGAGTGCCCGTCAGTGGGTGTTGGCGGCCACCTAAGTGGAGGAGGATTTGGCACCATGGCAAGGAAGTATGGTTTATCTGCTGATAATGT...

CDS

Download CDS FASTA

963 bp · TkA02G320530|TK1151|CDS

ATGGAGTCGAAGTTCTGTACATTCATCTGCAGCGTTGAATCTAAACTCCAAATTCGAATCCGAAGCGGCGGCCATGATGACGAAGGCCTTTCCTACACCTCCCATGATCACACCCCTTTCATCCTTCTTGACATGAGCAAACTCCGTAATAATCTTGGATTCCCGGCGGGAGAGTGCCCGTCAGTGGGTGTTGGCGGCCACCTAAGTGGAGGAGGATTTGGCACCATGGCAAGGAAGTATGGTTTATCTGCTGATAATGT...

Protein

Download Protein FASTA

320 aa · TkA02G320530|TK1151|PROTEIN

MESKFCTFICSVESKLQIRIRSGGHDDEGLSYTSHDHTPFILLDMSKLRNNLGFPAGECPSVGVGGHLSGGGFGTMARKYGLSADNVIDALIVDVNGRILDRKSMGEDLFWAIRGGGGGSFGNRLHRDELDRIGVYFSGYLRGESIEALKRKETLAEKLFQRKCFVVIEPHGGRMSEIDAAEIPYPHRDGNLYIIQYFTRWMDEDSDACEKNVDLCETSYVEALKWGEEASISLEISGVGNGERKVMLIQQNFFGHEQSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G320530`
TK1151 ID	TkA02G320530
OH-1004 ID	LXL04_015525
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	49.200
Protein coverage (%)	TK1151 81.875 / OH-1004 82.836 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G320530

Location Chr02:81417217-81419218 (+)

Description Similar to ASO: O-acetylstemmadenine oxidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34790`	Required for endosperm development and polar nuclei fusion.	No verified direct reference in this release
`At5g44390`	Berberine bridge enzyme-like 25.	No verified direct reference in this release
`At5g44400`	Berberine bridge enzyme-like 26.	No verified direct reference in this release
`At1g11770`	Berberine bridge enzyme-like 2.	No verified direct reference in this release
`At1g30700`	Berberine bridge enzyme-like 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015525 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009820 alkaloid metabolic process Biological Process

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031982 vesicle Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0050328 tetrahydroberberine oxidase activity Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ag:ADY15026

ag:AWJ76616

ath:AT5G44400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.376

Rank 1 · TkA02G320530 · TK1151

Cytoplasm0.231

Rank 2 · TkA02G320530 · TK1151

Lysosome / Vacuole0.090

Rank 3 · TkA02G320530 · TK1151

Endoplasmic reticulum0.085

Rank 4 · TkA02G320530 · TK1151

Nucleus0.080

Rank 5 · TkA02G320530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01565FAD_binding_413-50 aa

PF01565FAD_binding_452-100 aa

PF03478Beta-prop_KIB1-4289-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G320530	`PF01565`	FAD_binding_4	13	50	8.5e-09	36.0
TkA02G320530	`PF01565`	FAD_binding_4	52	100	8.5e-09	36.0
TkA02G320530	`PF03478`	Beta-prop_KIB1-4	289	315	0.036	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64743`	Arabidopsis thaliana	sp\|O64743\|BBE15_ARATH Monolignol oxidoreductase AtBBE-like 15	28.600%	Swiss-Prot	Low
`Q9FKU9`	Arabidopsis thaliana	sp\|Q9FKU9\|BBE25_ARATH Berberine bridge enzyme-like 25	28.300%	Swiss-Prot	Low
`Q9FKU8`	Arabidopsis thaliana	sp\|Q9FKU8\|BBE26_ARATH Berberine bridge enzyme-like 26	28.800%	Swiss-Prot	Low
`Q9SA99`	Arabidopsis thaliana	sp\|Q9SA99\|BBE2_ARATH Berberine bridge enzyme-like 2	53.500%	Swiss-Prot	Low
`Q9SA85`	Arabidopsis thaliana	sp\|Q9SA85\|BBE8_ARATH Berberine bridge enzyme-like 8	51.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card