RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G314840
Reference: TK1151 Chr: Chr02 Coordinates: 80019914-80020604 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

465 bp · TkA02G314840|TK1151|cDNA

AAGATCTGCGTGACCTCTTTTGTCTGCGCCGCGCAGACCACGCGCAGACCTAAGAGTTTGCAGTGTACTTGGATAGAAGTCTGCGTGACCTCTTCTAAACTTTCTAACCTAATAACTCCCGCTGTCTGCTCTCTTCCATCGCGATCCCGCTGCTCATGCTCAGTCCCGATCGTCTCCCTTCTTCAGTCCCGCAGACCATCGCCGGATTTCCTGAAATGGAACCCTGAATCGTCGTCGCCGGTACCTTGCGCCATTGTGTC...

CDS

Download CDS FASTA

465 bp · TkA02G314840|TK1151|CDS

AAGATCTGCGTGACCTCTTTTGTCTGCGCCGCGCAGACCACGCGCAGACCTAAGAGTTTGCAGTGTACTTGGATAGAAGTCTGCGTGACCTCTTCTAAACTTTCTAACCTAATAACTCCCGCTGTCTGCTCTCTTCCATCGCGATCCCGCTGCTCATGCTCAGTCCCGATCGTCTCCCTTCTTCAGTCCCGCAGACCATCGCCGGATTTCCTGAAATGGAACCCTGAATCGTCGTCGCCGGTACCTTGCGCCATTGTGTC...

Protein

Download Protein FASTA

154 aa · TkA02G314840|TK1151|PROTEIN

KICVTSFVCAAQTTRRPKSLQCTWIEVCVTSSKLSNLITPAVCSLPSRSRCSCSVPIVSLLQSRRPSPDFLKWNPESSSPVPCAIVSTIAVVTLLRTPNCRRLLPAQRLPTPVRSPCSAPADAASISPAPVNCRRRLHLSSIRAPISQISFKFE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G314840
TK1151 IDTkA02G314840
OH-1004 IDLXL04_031424
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)99.200
Protein coverage (%)TK1151 81.818 / OH-1004 24.561
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G314840
LocationChr02:80019914-80020604 (+)
DescriptionSimilar to RAX3: Transcription factor RAX3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031424 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0008285 negative regulation of cell population proliferation Biological Process
GO:0009664 plant-type cell wall organization Biological Process
GO:0009785 blue light signaling pathway Biological Process
GO:0030154 cell differentiation Biological Process
GO:0045597 positive regulation of cell differentiation Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0050801 monoatomic ion homeostasis Biological Process
GO:0090506 axillary shoot meristem initiation Biological Process
GO:2000067 regulation of root morphogenesis Biological Process
KEGG gene cross-reference
ath:AT2G36890
ath:AT3G49690
ath:AT4G37780
ath:AT5G23000
ath:AT5G57620
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.487
Rank 1 · TkA02G314840 · TK1151
Cytoplasm0.448
Rank 2 · TkA02G314840 · TK1151
Cell membrane0.110
Rank 3 · TkA02G314840 · TK1151
Endoplasmic reticulum0.089
Rank 4 · TkA02G314840 · TK1151
Plastid0.039
Rank 5 · TkA02G314840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser