TkA02G314050 | RubberDandelionOmics

Gene overview

TkA02G314050

Reference: TK1151 Chr: Chr02 Coordinates: 79879587-79880879 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1053 bp · TkA02G314050|TK1151|cDNA

ATGGTGTTTTTTCAGTTTGTTTTCGCGGCCATCACTTTGATTCTGATAGCCGGAGCAGTTTTGGGACGGATGAACTTTTATGCGTGGATGCTGTTTGTTCCACTTTGGCTAACCTTTTCGTACACCGTGGGTGCGTTTACCATTTGGTCTACTAATGGTTGGTTAGCTTTAATGGGAATAATCGATTATTCAGGTGGTTATGTTATCCATCTTTCTTCAGGAGTTGCTGGTTTCACCGCCGCTTATTGGGTTGGTCCAAG...

CDS

Download CDS FASTA

1053 bp · TkA02G314050|TK1151|CDS

ATGGTGTTTTTTCAGTTTGTTTTCGCGGCCATCACTTTGATTCTGATAGCCGGAGCAGTTTTGGGACGGATGAACTTTTATGCGTGGATGCTGTTTGTTCCACTTTGGCTAACCTTTTCGTACACCGTGGGTGCGTTTACCATTTGGTCTACTAATGGTTGGTTAGCTTTAATGGGAATAATCGATTATTCAGGTGGTTATGTTATCCATCTTTCTTCAGGAGTTGCTGGTTTCACCGCCGCTTATTGGGTTGGTCCAAG...

Protein

Download Protein FASTA

350 aa · TkA02G314050|TK1151|PROTEIN

MVFFQFVFAAITLILIAGAVLGRMNFYAWMLFVPLWLTFSYTVGAFTIWSTNGWLALMGIIDYSGGYVIHLSSGVAGFTAAYWVGPRLTKDRERFPPNNVILMLAGAGLLWMGWTGFNGGDPYTASADASLAVLNTHVCAATSLLTWLILDVAFFKKASVIGAVQGMITGLVAITPAAGVVQGYSAILMGLLSGSIPWFTMMVVHKKSELLQKVDDTMAVLHTHAVAGCLGGILTGLFSEPHLCELFYGSTNKYMGLFAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G314050`
TK1151 ID	TkA02G314050
OH-1004 ID	LXL04_005276
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	76.400
Protein coverage (%)	TK1151 99.429 / OH-1004 73.061 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G314050

Location Chr02:79879587-79880879 (+)

Description Similar to AMT2-5: Ammonium transporter 2 member 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0870300`	Involved in ammonium transport.	No verified direct reference in this release
`Os03g0838400`	Involved in ammonium transport.	No verified direct reference in this release
`Os02g0550800`	Involved in ammonium transport.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005276 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009610 response to symbiotic fungus Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0072488 ammonium transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0085042 periarbuscular membrane Cellular Component

GO:0008519 ammonium channel activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0870300

dosa:Os02g0550800

mtr:11423183

mtr:11444316

mtr:25482762

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.769

Rank 1 · TkA02G314050 · TK1151

Cytoplasm0.107

Rank 2 · TkA02G314050 · TK1151

Endoplasmic reticulum0.083

Rank 3 · TkA02G314050 · TK1151

Lysosome / Vacuole0.079

Rank 4 · TkA02G314050 · TK1151

Golgi apparatus0.039

Rank 5 · TkA02G314050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00909Ammonium_transp2-316 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G314050	`PF00909`	Ammonium_transp	2	316	8.4e-65	219.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84KJ6`	Oryza sativa subsp. japonica	sp\|Q84KJ6\|AMT31_ORYSJ Ammonium transporter 3 member 1	66.500%	Swiss-Prot	High
`Q851M9`	Oryza sativa subsp. japonica	sp\|Q851M9\|AMT32_ORYSJ Ammonium transporter 3 member 2	61.700%	Swiss-Prot	High
`Q69T29`	Oryza sativa subsp. japonica	sp\|Q69T29\|AMT33_ORYSJ Ammonium transporter 3 member 3	63.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card