TkA02G309960 | RubberDandelionOmics

Gene overview

TkA02G309960

Reference: TK1151 Chr: Chr02 Coordinates: 78885373-78887990 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

504 bp · TkA02G309960|TK1151|CDS

ATGGTTGGGCCGGAGCTTTCAGCCGGAAAACTTCTTCCTGGACTTGTAATCGGTTTCATTTTCGGTATGCTATTGGATTTATCACCGATCAAAAGGACTACAAATACAATGAGAAAGAGAAGTGGATTTTCATCAAGTTCAAGCCCTGATGAAAATCTTAAAATGGTTCTTGTTGTTAGGCAAGATTTGAAGATGGGACAAGGAAAAATTGCATCACAATGTGCTCATGCTGCCACTGGTTTATATTCTAAACTAATGCA...

Protein

Download Protein FASTA

167 aa · TkA02G309960|TK1151|PROTEIN

MVGPELSAGKLLPGLVIGFIFGMLLDLSPIKRTTNTMRKRSGFSSSSSPDENLKMVLVVRQDLKMGQGKIASQCAHAATGLYSKLMQSHRNLLHRWESSGQAKIVVTCKNQQEMNKLQETAEGTGLPTYVVADAGRTQVLAGSKTVLAIGPGYNSIVDSVTGKQRLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G309960`
TK1151 ID	TkA02G309960
OH-1004 ID	LXL04_016137
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	50.000
Protein coverage (%)	TK1151 40.719 / OH-1004 19.825 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G309960`
Location	Chr02:78885373-78887990 (+)
Description	Similar to PAS1: Peptidyl-prolyl cis-trans isomerase PASTICCINO1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016137` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009735 response to cytokinin Biological Process GO:0009736 cytokinin-activated signaling pathway Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0009880 embryonic pattern specification Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0030010 establishment of cell polarity Biological Process GO:0030154 cell differentiation Biological Process GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0048364 root development Biological Process
KEGG gene cross-reference	ath:AT3G54010 bta:516595 dme:Dmel_CG1307 hsa:51651 mmu:217057 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.604

Rank 1 · TkA02G309960 · TK1151

Plastid0.192

Rank 2 · TkA02G309960 · TK1151

Cytoplasm0.094

Rank 3 · TkA02G309960 · TK1151

Endoplasmic reticulum0.071

Rank 4 · TkA02G309960 · TK1151

Nucleus0.051

Rank 5 · TkA02G309960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15223EPOP27-137 aa

PF01981PTH253-167 aa

PF00731AIRC84-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G309960	`PF15223`	EPOP	27	137	0.26	11.5
TkA02G309960	`PF01981`	PTH2	53	167	1.6e-44	151.5
TkA02G309960	`PF00731`	AIRC	84	143	0.054	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card