Gene Card
Gene overview
cDNA / CDS / Protein Sequences
785 bp · TkA02G309800|TK1151|cDNA
CCGGAGCCTCTCACCGACCGAGTCCTCCGTGCACTCGAACACCGTCTCCGTCTCCTCCACCGCTCTAACAACGACTTCTTCATCTTAGGCGCCACCGGAAATGTCTACACAGTCACCCTCTCCGCCTCTCCATCCTGCACATGCCCTGACAGCACCACCCCATGCAAACACATCCTCTTCGTCTTCATCCGCCTTCTCTCTGTCTCCCTAGACGACCCTTGTTTATGGCGCCGCACCCTCCGCCCCTGCCAACTCAACCG...
375 bp · TkA02G309800|TK1151|CDS
ATGCCGTTGCTGGTGCAGCCATCCGCCAACGCTATAAAGAACTGTATCTCCACCGTGCCACCACAAACCCAGGTGCCGCCGGTGCAGGTGGAAGAGGGTTCAACGTGTCCGGTGTGTCTGGAGGAGATGGGGACAGGGGATCGGAAACTTGTGGCATGTGAGAGTTGTAAGAATCCGATTCATGAAGAGTGTTTCATGGCATGGAAGAGGAGTAGTAGGAGAAGATCGACGAGTTGCGTGATGTGTCGAGCAAGGTGGAG...
Protein
Download Protein FASTA124 aa · TkA02G309800|TK1151|PROTEIN
MPLLVQPSANAIKNCISTVPPQTQVPPVQVEEGSTCPVCLEEMGTGDRKLVACESCKNPIHEECFMAWKRSSRRRSTSCVMCRARWRDPAEQRRWLEIRNFLWEGDESRKKINVQKAVSRKTSA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G309800 |
|---|---|
| TK1151 ID | TkA02G309800 |
| OH-1004 ID | LXL04_015606 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 94.900 |
| Protein coverage (%) | TK1151 79.032 / OH-1004 37.405Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G309800 |
|---|---|
| Location | Chr02:78840486-78843270 (-) |
| Description | Similar to Map3k1: Mitogen-activated protein kinase kinase kinase 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000165 MAPK cascade Biological Process GO:0000209 protein polyubiquitination Biological Process GO:0006468 protein phosphorylation Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0007254 JNK cascade Biological Process GO:0018105 peptidyl-serine phosphorylation Biological Process GO:0030334 regulation of cell migration Biological Process GO:0030838 positive regulation of actin filament polymerization Biological Process GO:0032232 negative regulation of actin filament bundle assembly Biological Process GO:0038095 Fc-epsilon receptor signaling pathway Biological Process GO:0043406 positive regulation of MAP kinase activity Biological Process GO:0043410 positive regulation of MAPK cascade Biological Process |
| KEGG gene cross-reference | hsa:4214 rno:116667 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00130C1_113-24 aaPF12511DUF371614-39 aaPF22908PHD_NSD14-38 aaPF09237GAGA20-40 aaPF10367zf-Vps39_C27-45 aaPF14569zf-UDP28-87 aaPF00130C1_131-69 aaPF03107C1_231-64 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G309800 | PF00130 | C1_1 | 13 | 24 | 0.00023 | 21.6 |
| TkA02G309800 | PF12511 | DUF3716 | 14 | 39 | 3.0 | 8.6 |
| TkA02G309800 | PF22908 | PHD_NSD | 14 | 38 | 3.0 | 8.9 |
| TkA02G309800 | PF09237 | GAGA | 20 | 40 | 0.0057 | 17.5 |
| TkA02G309800 | PF10367 | zf-Vps39_C | 27 | 45 | 0.0058 | 16.9 |
| TkA02G309800 | PF14569 | zf-UDP | 28 | 87 | 0.0012 | 19.5 |
| TkA02G309800 | PF00130 | C1_1 | 31 | 69 | 0.00023 | 21.6 |
| TkA02G309800 | PF03107 | C1_2 | 31 | 64 | 0.25 | 12.4 |
| TkA02G309800 | PF14446 | Prok-RING_1 | 32 | 66 | 4.8e-06 | 27.4 |
| TkA02G309800 | PF13920 | zf-C3HC4_3 | 33 | 42 | 1.4 | 9.5 |
| TkA02G309800 | PF12861 | zf-ANAPC11 | 34 | 86 | 0.00048 | 20.8 |
| TkA02G309800 | PF08746 | zf-RING-like | 34 | 39 | 3.7 | 8.5 |
| TkA02G309800 | PF13831 | PHD_2 | 34 | 39 | 6.1 | 7.1 |
| TkA02G309800 | PF13639 | zf-RING_2 | 35 | 83 | 2.3e-07 | 31.7 |
| TkA02G309800 | PF11793 | FANCL_C | 35 | 78 | 0.0035 | 18.3 |
| TkA02G309800 | PF13453 | Zn_ribbon_TFIIB | 35 | 57 | 0.022 | 14.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.