RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G309780
Reference: TK1151 Chr: Chr02 Coordinates: 78837372-78837816 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

336 bp · TkA02G309780|TK1151|cDNA

ATGGCGTCGCAACCTCCACCCCTGCCAAGTCACCCGCCTCCTCTCTGCTCCCGTCTCTGCAGACGCCGTTGCTGGTGTAGCCATCCGACAACGCTTCCAGGAGATATATCTCCACCGTGCCGCCACCAACCCAGTCCGATTCATGAAGATTGTTTCATGGCATGGAAGAGAAGTAGTCGGAGAAGATCAACGTGTTGTGTGATATGTCGAGCAAGGTGGAGAGATCGAGCTGAACAGGAGAAGTATATTAACCTGTCGGC...

CDS

Download CDS FASTA

336 bp · TkA02G309780|TK1151|CDS

ATGGCGTCGCAACCTCCACCCCTGCCAAGTCACCCGCCTCCTCTCTGCTCCCGTCTCTGCAGACGCCGTTGCTGGTGTAGCCATCCGACAACGCTTCCAGGAGATATATCTCCACCGTGCCGCCACCAACCCAGTCCGATTCATGAAGATTGTTTCATGGCATGGAAGAGAAGTAGTCGGAGAAGATCAACGTGTTGTGTGATATGTCGAGCAAGGTGGAGAGATCGAGCTGAACAGGAGAAGTATATTAACCTGTCGGC...

Protein

Download Protein FASTA

111 aa · TkA02G309780|TK1151|PROTEIN

MASQPPPLPSHPPPLCSRLCRRRCWCSHPTTLPGDISPPCRHQPSPIHEDCFMAWKRSSRRRSTCCVICRARWRDRAEQEKYINLSAYLSEDENTIRDQQGEEYCGVNLSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G309780
TK1151 IDTkA02G309780
OH-1004 IDLXL04_015606
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)65.400
Protein coverage (%)TK1151 46.847 / OH-1004 19.847
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G309780
LocationChr02:78837372-78837816 (-)
DescriptionSimilar to Map3k1: Mitogen-activated protein kinase kinase kinase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015606 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000165 MAPK cascade Biological Process
GO:0000209 protein polyubiquitination Biological Process
GO:0006468 protein phosphorylation Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0007254 JNK cascade Biological Process
GO:0018105 peptidyl-serine phosphorylation Biological Process
GO:0030334 regulation of cell migration Biological Process
GO:0030838 positive regulation of actin filament polymerization Biological Process
GO:0032232 negative regulation of actin filament bundle assembly Biological Process
GO:0038095 Fc-epsilon receptor signaling pathway Biological Process
GO:0043406 positive regulation of MAP kinase activity Biological Process
GO:0043410 positive regulation of MAPK cascade Biological Process
KEGG gene cross-reference
hsa:4214
rno:116667
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.407
Rank 1 · TkA02G309780 · TK1151
Cytoplasm0.406
Rank 2 · TkA02G309780 · TK1151
Mitochondrion0.133
Rank 3 · TkA02G309780 · TK1151
Cell membrane0.130
Rank 4 · TkA02G309780 · TK1151
Endoplasmic reticulum0.111
Rank 5 · TkA02G309780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser