TkA02G308450 | RubberDandelionOmics

Gene overview

TkA02G308450

Reference: TK1151 Chr: Chr02 Coordinates: 78486504-78487457 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · TkA02G308450|TK1151|cDNA

GCATCAAGGGCAAGGCTTTTTAAGGAATACAAAGAAGTGCAGCGAGAGAAGGTAGCCGACCCTGATATTCAACTCGTTTGTGATGAATCCAACATTTTTAAATGGACAGCTCTCATAAAGGGGCCATCAGAAACTCCTTATGATGGTGGAGTTTTCCAGCTTGCTTTTTCAATACCTGAGCAGTATCCTTTGCAGCCTCCTCAAGTTCGTTACTTAACCAAAATATTCCATCCAAATGTACATTTCAAGACAGGTGAGAT...

CDS

Download CDS FASTA

468 bp · TkA02G308450|TK1151|CDS

GCATCAAGGGCAAGGCTTTTTAAGGAATACAAAGAAGTGCAGCGAGAGAAGGTAGCCGACCCTGATATTCAACTCGTTTGTGATGAATCCAACATTTTTAAATGGACAGCTCTCATAAAGGGGCCATCAGAAACTCCTTATGATGGTGGAGTTTTCCAGCTTGCTTTTTCAATACCTGAGCAGTATCCTTTGCAGCCTCCTCAAGTTCGTTACTTAACCAAAATATTCCATCCAAATGTACATTTCAAGACAGGTGAGAT...

Protein

Download Protein FASTA

155 aa · TkA02G308450|TK1151|PROTEIN

ASRARLFKEYKEVQREKVADPDIQLVCDESNIFKWTALIKGPSETPYDGGVFQLAFSIPEQYPLQPPQVRYLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDIRGYQSMARMYTRLAAMPKKG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G308450`
TK1151 ID	TkA02G308450
OH-1004 ID	LXL04_019061
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.800
Protein coverage (%)	TK1151 100.000 / OH-1004 98.726 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G308450

Location Chr02:78486504-78487457 (-)

Description Similar to PEX4: Protein PEROXIN-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25760`	E2 ubiquitin-conjugating enzyme involved in the ubiquitination of proteins associated with the peroxisomal membrane.	Ubiquitin-conjugating activity by PEX4 is required for efficient protein transport to peroxisomes in Arabidopsis thaliana.2022 · DOI: 10.1016/j.jbc.2022.102038

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019061 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0007031 peroxisome organization Biological Process

GO:0016558 protein import into peroxisome matrix Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G25760

ddi:DDB_G0274313

spo:2539961

tbr:Tb927.8.920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.614

Rank 1 · TkA02G308450 · TK1151

Cytoplasm0.545

Rank 2 · TkA02G308450 · TK1151

Cell membrane0.061

Rank 3 · TkA02G308450 · TK1151

Endoplasmic reticulum0.053

Rank 4 · TkA02G308450 · TK1151

Mitochondrion0.053

Rank 5 · TkA02G308450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179UQ_con5-144 aa

PF14461Prok-E2_B11-30 aa

PF14461Prok-E2_B45-109 aa

PF05773RWD49-75 aa

PF08694UFC151-101 aa

PF14457Prok-E2_A59-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G308450	`PF00179`	UQ_con	5	144	3e-43	147.5
TkA02G308450	`PF14461`	Prok-E2_B	11	30	0.013	16.2
TkA02G308450	`PF14461`	Prok-E2_B	45	109	0.013	16.2
TkA02G308450	`PF05773`	RWD	49	75	0.053	14.4
TkA02G308450	`PF08694`	UFC1	51	101	0.0092	16.4
TkA02G308450	`PF14457`	Prok-E2_A	59	112	0.11	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGF7`	Arabidopsis thaliana	sp\|Q8LGF7\|PEX4_ARATH Ubiquitin-conjugating enzyme E2 PEX4	92.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card