TkA02G308260 | RubberDandelionOmics

Gene overview

TkA02G308260

Reference: TK1151 Chr: Chr02 Coordinates: 78442022-78445478 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1833 bp · TkA02G308260|TK1151|cDNA

CTAAAACTAAAAGCTCAAAACTAGTAAGAGAGCTACCCGGACACCGGAAAGAAATTACAAAGAATTCAGAAATCAAAGATTTGGAATAAAAGCGGGGAGTAATCGAATTGGCGTCAAAAATTTTGAATTTTACTTTCCCAATTTGCTTTGTTTGATCATGTTAATACCTCAAGATCACGCGCAATACGCAAACCCTCAAATCTGTGTTGTGTCCTGAGATTTAGGGTTTTTACAAGAAACTTAAATCCCTTTTGCGCTCA...

CDS

Download CDS FASTA

1362 bp · TkA02G308260|TK1151|CDS

ATGGATGGGAGGCGGATAACTGCGAATCCACGGCCGTCTACTTGTCGGCGGGTGGTTGCGAAGAAGCGGCAGCGTGGAGGTGTTGATGGGTTTGTGAATAGCGTTAAGAAACTTCAGAGGAGAGAAATATGTTCGAAAAGGGGACGTGCTTTTAGTATGTGTGATGCTCAGGAGAGGTTCAGAAATATTCGGCTACAGGAAGAGTATGACACCCATGATCCCAAGGGACACTGTCCTACAGTATTACCATTTCTCAAAAA...

Protein

Download Protein FASTA

453 aa · TkA02G308260|TK1151|PROTEIN

MDGRRITANPRPSTCRRVVAKKRQRGGVDGFVNSVKKLQRREICSKRGRAFSMCDAQERFRNIRLQEEYDTHDPKGHCPTVLPFLKNRSKILEIVAAHDIVFALAQSGVCAAFNRETNKRICFLNVTPDEVIRSLFYNKNNDSLITVSMYASDSFSSLKCRTTRIEYIRRGQPDAGFALFESESLKWPGFVEFDDVNGKVLTFSAQDSIYKVFDLKNYMMLYSISDKNVQEIKISPGIMLLIYNQSSGHVPLKILSIEDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G308260`
TK1151 ID	TkA02G308260
OH-1004 ID	LXL04_012109
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 99.779 / OH-1004 36.247 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G308260`
Location	Chr02:78442022-78445478 (-)
Description	Similar to CIP7: COP1-interacting protein 7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012109` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0009416 response to light stimulus Biological Process GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process GO:0015995 chlorophyll biosynthetic process Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT4G27430 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.506

Rank 1 · TkA02G308260 · TK1151

Cytoplasm0.448

Rank 2 · TkA02G308260 · TK1151

Mitochondrion0.057

Rank 3 · TkA02G308260 · TK1151

Cell membrane0.051

Rank 4 · TkA02G308260 · TK1151

Endoplasmic reticulum0.036

Rank 5 · TkA02G308260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25463DUF789949-451 aa

PF25171Beta-prop_WDR36-Utp21_1st92-122 aa

PF23393Beta-prop_WDR90_POC16_2nd99-134 aa

PF23756Beta-prop_HPS5108-142 aa

PF24796WDR55128-148 aa

PF23381Beta-prop_IFT122_1st129-149 aa

PF25174Beta-prop_THOC3192-266 aa

PF25175Beta-prop_WDR5196-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G308260	`PF25463`	DUF7899	49	451	8.8e-221	733.2
TkA02G308260	`PF25171`	Beta-prop_WDR36-Utp21_1st	92	122	0.00066	19.9
TkA02G308260	`PF23393`	Beta-prop_WDR90_POC16_2nd	99	134	0.00024	21.1
TkA02G308260	`PF23756`	Beta-prop_HPS5	108	142	0.0042	17.1
TkA02G308260	`PF24796`	WDR55	128	148	0.0026	17.6
TkA02G308260	`PF23381`	Beta-prop_IFT122_1st	129	149	0.0098	16.0
TkA02G308260	`PF25174`	Beta-prop_THOC3	192	266	0.00026	20.8
TkA02G308260	`PF25175`	Beta-prop_WDR5	196	310	0.0043	17.1
TkA02G308260	`PF23393`	Beta-prop_WDR90_POC16_2nd	197	259	0.00024	21.1
TkA02G308260	`PF14890`	Intein_splicing	206	283	0.062	13.8
TkA02G308260	`PF25171`	Beta-prop_WDR36-Utp21_1st	209	451	0.00066	19.9
TkA02G308260	`PF29037`	DSE1_N	221	329	0.0042	16.9
TkA02G308260	`PF24796`	WDR55	226	344	0.0026	17.6
TkA02G308260	`PF23756`	Beta-prop_HPS5	250	332	0.0042	17.1
TkA02G308260	`PF23381`	Beta-prop_IFT122_1st	258	360	0.0098	16.0
TkA02G308260	`PF23393`	Beta-prop_WDR90_POC16_2nd	267	376	0.00024	21.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card