Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1465 bp · TkA02G306790|TK1151|cDNA
AATCCTGACAATTTCGCCTTGATGACTGAAGCAGTGGCCGAGGAAGGAAGATTTCAGCCGAAAATGATGAATTTCGGCTGTGTCTTGGCCAAAATTCTTGAGGCTGATGAACAGCTCCGAAAATTGCTTTATTCTTTGATGATTGATCCGAAAATTCAAGCTCTGATACCAATTGTTTTAACAACGCAACTCCTGTGTCACCAATCACCATCAATGGCCCCGCCGGAAGAAGCTTTATCCGTCTTTACAAATAAAGATCA...
963 bp · TkA02G306790|TK1151|CDS
ATGGTCGGGTGCTGTAACTTCGCGGCGTGCGGCGAGTGCTGTCTTACACGATCATTCGGGTCAGCCGGCCTAAAATCTACAACCACCACCCTCCACGACGGAGACACCACCATCCACTGCTGGATACCCAAAACCTACAAACTTACCAAACCCAATTTGGTCCTGGTTCATGGAATTGGAGCCAACGCCAAATGGCAGTGGACTCGAATAATCTCCCGTGTCACTCCCCTTTTCAACGTCTACGTTCCCGATTTACCCTT...
Protein
Download Protein FASTA320 aa · TkA02G306790|TK1151|PROTEIN
MVGCCNFAACGECCLTRSFGSAGLKSTTTTLHDGDTTIHCWIPKTYKLTKPNLVLVHGIGANAKWQWTRIISRVTPLFNVYVPDLPFYGDSHTKRLDRTEHFQAECVMQTLEAVGLMGKINLVGLSYGGFVGYSMAAKFPDAVERVALIGGGVCLDSEIDLEEGLFSAKNIKTAAKVLLAQTPEETRELLRITFYNPPHAKLAPNCLLNDYIQEMNVDYFEEKKECIEAVQKDRKYSDLPKITQPTLIIWGEQDQIFPVD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G306790 |
|---|---|
| TK1151 ID | TkA02G306790 |
| OH-1004 ID | LXL04_015653 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G306790 |
|---|---|
| Location | Chr02:78089730-78093231 (+) |
| Description | Similar to ABHD6: Monoacylglycerol lipase ABHD6 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009395 phospholipid catabolic process Biological Process GO:0019369 arachidonate metabolic process Biological Process GO:0019380 3-phenylpropionate catabolic process Biological Process GO:0030336 negative regulation of cell migration Biological Process GO:0046464 acylglycerol catabolic process Biological Process GO:0046889 positive regulation of lipid biosynthetic process Biological Process GO:0052651 monoacylglycerol catabolic process Biological Process GO:0120163 negative regulation of cold-induced thermogenesis Biological Process GO:2000124 regulation of endocannabinoid signaling pathway Biological Process GO:2001311 lysobisphosphatidic acid metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component |
| KEGG gene cross-reference | bta:505283 hsa:57406 mmu:66082 reu:Reut_A0274 rno:305795 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00561Abhydrolase_151-289 aaPF20408Abhydrolase_1151-137 aaPF12146Hydrolase_452-289 aaPF12697Abhydrolase_653-295 aaPF05728UPF022799-138 aaPF01738DLH108-159 aaPF02129Peptidase_S15118-258 aaPF08840BAAT_C118-167 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G306790 | PF00561 | Abhydrolase_1 | 51 | 289 | 3.3e-24 | 86.6 |
| TkA02G306790 | PF20408 | Abhydrolase_11 | 51 | 137 | 0.19 | 12.2 |
| TkA02G306790 | PF12146 | Hydrolase_4 | 52 | 289 | 2.2e-06 | 27.9 |
| TkA02G306790 | PF12697 | Abhydrolase_6 | 53 | 295 | 5.1e-18 | 67.2 |
| TkA02G306790 | PF05728 | UPF0227 | 99 | 138 | 0.03 | 14.9 |
| TkA02G306790 | PF01738 | DLH | 108 | 159 | 0.031 | 14.6 |
| TkA02G306790 | PF02129 | Peptidase_S15 | 118 | 258 | 3.9e-06 | 27.5 |
| TkA02G306790 | PF08840 | BAAT_C | 118 | 167 | 0.0053 | 17.5 |
| TkA02G306790 | PF00326 | Peptidase_S9 | 119 | 141 | 0.11 | 12.7 |
| TkA02G306790 | PF03959 | FSH1 | 122 | 139 | 0.26 | 11.7 |
| TkA02G306790 | PF05728 | UPF0227 | 202 | 286 | 0.03 | 14.9 |
| TkA02G306790 | PF00326 | Peptidase_S9 | 231 | 289 | 0.11 | 12.7 |
| TkA02G306790 | PF20408 | Abhydrolase_11 | 233 | 257 | 0.19 | 12.2 |
| TkA02G306790 | PF01738 | DLH | 234 | 286 | 0.031 | 14.6 |
| TkA02G306790 | PF03959 | FSH1 | 234 | 285 | 0.26 | 11.7 |
| TkA02G306790 | PF08386 | Abhydrolase_4 | 240 | 289 | 0.013 | 16.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.