RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G305750
Reference: TK1151 Chr: Chr02 Coordinates: 77839732-77846060 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2541 bp · TkA02G305750|TK1151|cDNA

CTTGAAACTTTCGAGAGTTGCAAAAATCTCTCGTTTGGAGAGCCACCACCTACCATATGTGTGTTTTGGGGGAGAAGGCGCATGTGACGATTACTTTTAAAAATTCCCCAAATTGATTTGACAGACTATCCACAAGGAGAAGAAGAAGAACACCTCGAAGCTTCTCTGTTGACCTCTGTTCATCTGCTAAAAGTCCTGCTTGCGATCCTTCATAAAGGTAAGCCCGATCTAGTTTACTTATGGGTCTATATGTGTAATTA...

CDS

Download CDS FASTA

1812 bp · TkA02G305750|TK1151|CDS

ATGGAGCTAATATTACTACTTATTCTATTGGGAAATTTGCATTTTGTAGCCCCCGATGCTCAAGGAGATGCACTCTTTGAATTGAGAACCTCACTTAAGGCTTCACGTGATCAACTCACGGATTGGAACCAGAATCAAGTGAATCCATGCACTTGGACTAAAGTTAGTTGTGATGCAAATAACAATGTTTTTTCTGTATCTATGTCGTTCATGGGATTTAGAGGATCCTTGTCACCAAGAATACAAGTTTTATCAAAGCT...

Protein

Download Protein FASTA

603 aa · TkA02G305750|TK1151|PROTEIN

MELILLLILLGNLHFVAPDAQGDALFELRTSLKASRDQLTDWNQNQVNPCTWTKVSCDANNNVFSVSMSFMGFRGSLSPRIQVLSKLAILSLQGNEITGGIPEEYGNLSSLTMLDLESNRLTGQIPSSLGNLKNLQFLILSQNNLEGPIPDSLSSLPNLTSILLGSNNLSGQIPDHLFQVSKYNFTGNRLNCGFNNTHPCVSRSEDGSKKSKAGIVIGVIGGVLGLLLLGCLVLFLWRGRNKGYKREVFVDVAGEVDRRI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G305750
TK1151 IDTkA02G305750
OH-1004 IDLXL04_003390
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)56.400
Protein coverage (%)TK1151 99.668 / OH-1004 91.469
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G305750
LocationChr02:77839732-77846060 (-)
DescriptionSimilar to At5g63710: Probable LRR receptor-like serine/threonine-protein kinase At5g63710
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g10290 Probable LRR receptor-like serine/threonine-protein kinase At5g10290. No verified direct reference in this release
At5g65240 Probable LRR receptor-like serine/threonine-protein kinase At5g65240. No verified direct reference in this release
At5g63710 Probable LRR receptor-like serine/threonine-protein kinase At5g63710. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0283800 May be involved in the regulation of plant growth through the brassinosteroid (BR) signaling pathway. No verified direct reference in this release
Os04g0457800 LRR receptor kinase involved in positive regulation of somatic embryogenesis and defense response against the rice blast fungus pathogen Magnaporthe oryzae.
Rice SERK1 gene positively regulates somatic embryogenesis of cultured cell and host defense response against fungal infection.2005 · DOI: 10.1007/s00425-005-1534-4
An XA21-associated kinase (OsSERK2) regulates immunity mediated by the XA21 and XA3 immune receptors.2014 · DOI: 10.1093/mp/ssu003
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_003390 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002213 defense response to insect Biological Process
GO:0007165 signal transduction Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009536 plastid Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0042802 identical protein binding Molecular Function
GO:0042803 protein homodimerization activity Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT5G10290
ath:AT5G63710
ath:AT5G65240
dosa:Os02g0283800
osa:4329032
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.884
Rank 1 · TkA02G305750 · TK1151
Cytoplasm0.078
Rank 2 · TkA02G305750 · TK1151
Endoplasmic reticulum0.073
Rank 3 · TkA02G305750 · TK1151
Nucleus0.049
Rank 4 · TkA02G305750 · TK1151
Golgi apparatus0.020
Rank 5 · TkA02G305750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_219-58 aa
PF24141LRR_ComC70-131 aa
PF23211LRR_LRWD179-167 aa
PF23598LRR_1481-162 aa
PF29252LRR_NLRC482-116 aa
PF13855LRR_884-121 aa
PF00560LRR_187-108 aa
PF12799LRR_487-121 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G305750PF08263LRRNT_219582.4e-1041.2
TkA02G305750PF24141LRR_ComC701310.989.7
TkA02G305750PF23211LRR_LRWD1791670.001818.7
TkA02G305750PF23598LRR_14811621.7e-0731.0
TkA02G305750PF29252LRR_NLRC4821160.003117.5
TkA02G305750PF13855LRR_8841214.4e-1143.1
TkA02G305750PF00560LRR_1871081.4e-1039.8
TkA02G305750PF12799LRR_4871211.6e-0835.2
TkA02G305750PF14580LRR_91031730.06513.5
TkA02G305750PF29252LRR_NLRC41071440.003117.5
TkA02G305750PF24141LRR_ComC1091900.989.7
TkA02G305750PF13855LRR_81101694.4e-1143.1
TkA02G305750PF00560LRR_11101321.4e-1039.8
TkA02G305750PF12799LRR_41331741.6e-0835.2
TkA02G305750PF00560LRR_11341561.4e-1039.8
TkA02G305750PF00560LRR_11581781.4e-1039.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
C0LGT1Arabidopsis thalianasp|C0LGT1|Y5129_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g1029080.200%Swiss-ProtHigh
C0LGX1Arabidopsis thalianasp|C0LGX1|Y5524_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g6524078.500%Swiss-ProtHigh
Q8W4S5Arabidopsis thalianasp|Q8W4S5|Y5371_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g6371058.200%Swiss-ProtHigh
Q6K4T4Oryza sativa subsp. japonicasp|Q6K4T4|SERK4_ORYSJ LRR receptor kinase SERK278.800%Swiss-ProtHigh
Q7XV05Oryza sativa subsp. japonicasp|Q7XV05|SERK2_ORYSJ LRR receptor kinase SERK260.000%Swiss-ProtHigh

JBrowse

View in Genome Browser