TkA02G305650 | RubberDandelionOmics

Gene overview

TkA02G305650

Reference: TK1151 Chr: Chr02 Coordinates: 77814085-77814472 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

321 bp · TkA02G305650|TK1151|cDNA

AACAGATGTGAATTGCATATATTAAGGGAGTTGGGTTTCGTGTGCCATGTTGAACTTCCTCATAAACTCGTGTTAAGTTACATTGCAGTTTTGGGGACACCTCCAGGGTTGCTTCAAGAAGCTTGGAATATTGTAAATGATAGCTTGCGGTCAACTTTATGTGTGCGGTTGAAGCCTGAGGTGGTTGCATGTGGCGTTTTATATATAGCTGCCCGCCGGGTACATGTTCCCCTGCCTGAAAACCCTCCATGGTGGGAAGC...

CDS

Download CDS FASTA

321 bp · TkA02G305650|TK1151|CDS

AACAGATGTGAATTGCATATATTAAGGGAGTTGGGTTTCGTGTGCCATGTTGAACTTCCTCATAAACTCGTGTTAAGTTACATTGCAGTTTTGGGGACACCTCCAGGGTTGCTTCAAGAAGCTTGGAATATTGTAAATGATAGCTTGCGGTCAACTTTATGTGTGCGGTTGAAGCCTGAGGTGGTTGCATGTGGCGTTTTATATATAGCTGCCCGCCGGGTACATGTTCCCCTGCCTGAAAACCCTCCATGGTGGGAAGC...

Protein

Download Protein FASTA

107 aa · TkA02G305650|TK1151|PROTEIN

NRCELHILRELGFVCHVELPHKLVLSYIAVLGTPPGLLQEAWNIVNDSLRSTLCVRLKPEVVACGVLYIAARRVHVPLPENPPWWEAFDADKRGIDQVCRVLARLYS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G305650`
TK1151 ID	TkA02G305650
OH-1004 ID	LXL04_015661
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 29.076 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G305650

Location Chr02:77814085-77814472 (-)

Description Similar to CYCL1-1: Cyclin-L1-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26430`	Cognate cyclin for CDKG1.	The splicing machinery promotes RNA-directed DNA methylation and transcriptional silencing in Arabidopsis.2013 · DOI: 10.1038/emboj.2013.49
`At1g35440`	Putative cyclin-T1-1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0377500`	Cyclin-L1-1.	No verified direct reference in this release
`Os02g0438200`	Cyclin-T1-2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015661 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009651 response to salt stress Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0046605 regulation of centrosome cycle Biological Process

GO:0048024 regulation of mRNA splicing, via spliceosome Biological Process

GO:0051301 cell division Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0051726 regulation of cell cycle Biological Process

KEGG gene cross-reference

ath:AT2G26430

dosa:Os01g0377500

dre:326088

mmu:56036

xtr:595011

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.620

Rank 1 · TkA02G305650 · TK1151

Cytoplasm0.417

Rank 2 · TkA02G305650 · TK1151

Cell membrane0.062

Rank 3 · TkA02G305650 · TK1151

Mitochondrion0.048

Rank 4 · TkA02G305650 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA02G305650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21797CycT2-like_C20-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G305650	`PF21797`	CycT2-like_C	20	90	3.2e-05	24.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWV3`	Arabidopsis thaliana	sp\|Q8RWV3\|CCL11_ARATH Cyclin-L1-1	72.000%	Swiss-Prot	High
`Q9C8P7`	Arabidopsis thaliana	sp\|Q9C8P7\|CCT11_ARATH Putative cyclin-T1-1	35.800%	Swiss-Prot	Medium
`Q9AS36`	Oryza sativa subsp. japonica	sp\|Q9AS36\|CCL11_ORYSJ Cyclin-L1-1	67.000%	Swiss-Prot	High
`Q6Z7H3`	Oryza sativa subsp. japonica	sp\|Q6Z7H3\|CCT12_ORYSJ Cyclin-T1-2	32.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card