TkA02G304770 | RubberDandelionOmics

Gene overview

TkA02G304770

Reference: TK1151 Chr: Chr02 Coordinates: 77592010-77592760 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · TkA02G304770|TK1151|cDNA

ACGCCATTCCTCCGACACCAGCCTCGATCTTCACCAGCCTCGATTTTCACCAGCTCCTCTCCACGCTTGCACGCCGATTCCCTTGCACGCCAGACGATTTCCATCTTCCATCTCTATATTTACCCTCCCGATTTCAAATGGAGATGCGATTGGTTTCGATTCCATCCCAATTTCACCTCCGACACACACAGGTATGGTTTCGTTCTTTCCTCCACCCTCTCTTCTTCCTTCCACAACAATCGTACCTCCATCGTTGTTGC...

CDS

Download CDS FASTA

525 bp · TkA02G304770|TK1151|CDS

ACGCCATTCCTCCGACACCAGCCTCGATCTTCACCAGCCTCGATTTTCACCAGCTCCTCTCCACGCTTGCACGCCGATTCCCTTGCACGCCAGACGATTTCCATCTTCCATCTCTATATTTACCCTCCCGATTTCAAATGGAGATGCGATTGGTTTCGATTCCATCCCAATTTCACCTCCGACACACACAGGTATGGTTTCGTTCTTTCCTCCACCCTCTCTTCTTCCTTCCACAACAATCGTACCTCCATCGTTGTTGC...

Protein

Download Protein FASTA

174 aa · TkA02G304770|TK1151|PROTEIN

TPFLRHQPRSSPASIFTSSSPRLHADSLARQTISIFHLYIYPPDFKWRCDWFRFHPNFTSDTHRYGFVLSSTLSSSFHNNRTSIVVAAQISLMHHLDDPTISLPLHRHHHRITLTAPPSHCSGTQSQVCSSMAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSSLHTTSRYP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G304770`
TK1151 ID	TkA02G304770
OH-1004 ID	LXL04_020562
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	85.300
Protein coverage (%)	TK1151 74.138 / OH-1004 34.232 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G304770

Location Chr02:77592010-77592760 (-)

Description Similar to Tbc1d8b: TBC1 domain family member 8B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42820`	Necessary for the splicing of pre-mRNA (By similarity).	No verified direct reference in this release
`At1g27650`	Necessary for the splicing of pre-mRNA (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0491756`	Necessary for the splicing of pre-mRNA.	No verified direct reference in this release
`Os05g0564200`	Necessary for the splicing of pre-mRNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020562 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003008 system process Biological Process

GO:0003094 glomerular filtration Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0005829 cytosol Cellular Component

GO:0005096 GTPase activator activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

dre:566657

hsa:23158

hsa:54885

mmu:245638

mmu:71310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.612

Rank 1 · TkA02G304770 · TK1151

Cytoplasm0.385

Rank 2 · TkA02G304770 · TK1151

Cell membrane0.064

Rank 3 · TkA02G304770 · TK1151

Endoplasmic reticulum0.060

Rank 4 · TkA02G304770 · TK1151

Mitochondrion0.053

Rank 5 · TkA02G304770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25585zf-CCCH_DUS3L45-51 aa

PF08368FAST_289-156 aa

PF25585zf-CCCH_DUS3L144-168 aa

PF00642zf-CCCH145-168 aa

PF18345zf_CCCH_4149-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G304770	`PF25585`	zf-CCCH_DUS3L	45	51	0.06	14.0
TkA02G304770	`PF08368`	FAST_2	89	156	0.26	12.6
TkA02G304770	`PF25585`	zf-CCCH_DUS3L	144	168	0.06	14.0
TkA02G304770	`PF00642`	zf-CCCH	145	168	1.9e-07	31.5
TkA02G304770	`PF18345`	zf_CCCH_4	149	168	0.006	17.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMY5`	Arabidopsis thaliana	sp\|Q9FMY5\|U2AFB_ARATH Splicing factor U2af small subunit B	97.300%	Swiss-Prot	Low
`Q9S709`	Arabidopsis thaliana	sp\|Q9S709\|U2AFA_ARATH Splicing factor U2af small subunit A	97.300%	Swiss-Prot	Low
`Q9ZQW8`	Oryza sativa subsp. japonica	sp\|Q9ZQW8\|U2AFA_ORYSJ Splicing factor U2af small subunit A	97.300%	Swiss-Prot	Low
`Q6AUG0`	Oryza sativa subsp. japonica	sp\|Q6AUG0\|U2AFB_ORYSJ Splicing factor U2af small subunit B	97.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card