TkA02G301380 | RubberDandelionOmics

Gene overview

TkA02G301380

Reference: TK1151 Chr: Chr02 Coordinates: 76792510-76793112 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

603 bp · TkA02G301380|TK1151|cDNA

ATGGGAAGAAGTCCAGAACAACTAGAAGATGTTGTGGAGTTGATACAAGATATACAATCACGGTTGCCCGTAAAAGAAGCGGCCCGCACCAGCATCCTCTCCAAGTCATGGCTCCATGCTTGGTCGACCATCCCTACCCTCCGATTTCATGTCCCCAATGATCAATATATAAAGCAATTGAAGTTGGTCTATATTGACCGCACTCTGACAAGGTATCTCAGTGACAACCTACCGATCGAAAGTTTTGACCTTAATTTCGA...

CDS

Download CDS FASTA

603 bp · TkA02G301380|TK1151|CDS

ATGGGAAGAAGTCCAGAACAACTAGAAGATGTTGTGGAGTTGATACAAGATATACAATCACGGTTGCCCGTAAAAGAAGCGGCCCGCACCAGCATCCTCTCCAAGTCATGGCTCCATGCTTGGTCGACCATCCCTACCCTCCGATTTCATGTCCCCAATGATCAATATATAAAGCAATTGAAGTTGGTCTATATTGACCGCACTCTGACAAGGTATCTCAGTGACAACCTACCGATCGAAAGTTTTGACCTTAATTTCGA...

Protein

Download Protein FASTA

200 aa · TkA02G301380|TK1151|PROTEIN

MGRSPEQLEDVVELIQDIQSRLPVKEAARTSILSKSWLHAWSTIPTLRFHVPNDQYIKQLKLVYIDRTLTRYLSDNLPIESFDLNFETENVESVSLSEKWIRSVATKTCLKELLLTIGFCGASFRLSNVIFSSENLTKLRVSADREMRIIGGPPLVNCVSLRELYLSCVRREQQLLDHILSSCRLLVKIELECCFWSLKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G301380`
TK1151 ID	TkA02G301380
OH-1004 ID	LXL04_006243
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	60.500
Protein coverage (%)	TK1151 92.000 / OH-1004 16.370 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G301380

Location Chr02:76792510-76793112 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006243 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference

ath:AT5G56410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.690

Rank 1 · TkA02G301380 · TK1151

Cytoplasm0.332

Rank 2 · TkA02G301380 · TK1151

Cell membrane0.058

Rank 3 · TkA02G301380 · TK1151

Endoplasmic reticulum0.056

Rank 4 · TkA02G301380 · TK1151

Plastid0.025

Rank 5 · TkA02G301380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box13-44 aa

PF12799LRR_472-98 aa

PF23622LRR_At1g61320_AtMIF182-194 aa

PF24758LRR_At5g5637098-195 aa

PF12799LRR_4135-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G301380	`PF00646`	F-box	13	44	0.0078	16.8
TkA02G301380	`PF12799`	LRR_4	72	98	0.032	15.2
TkA02G301380	`PF23622`	LRR_At1g61320_AtMIF1	82	194	0.017	15.3
TkA02G301380	`PF24758`	LRR_At5g56370	98	195	3.1e-07	31.0
TkA02G301380	`PF12799`	LRR_4	135	168	0.032	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	29.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card