TkA02G300680 | RubberDandelionOmics

Gene overview

TkA02G300680

Reference: TK1151 Chr: Chr02 Coordinates: 76638578-76645494 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

853 bp · TkA02G300680|TK1151|cDNA

CATTTCGTCCGGGTTTTTCCCATTCCGTACGGGTTTTTGCCATTCTGTCCGAGTTTTGGGCCTAACCTAAATTCATCCCGGCCCAATGTTAAAATAACCTATTGCCCGTTCACAGTTAGGATCGGAGGTGTTTTTGGGGATTTCTCTCTGGTTCGACGACATCGACCTCCAGCGACAGACAGGACGACGACCTCCACCACTCCAACGACCAGCTCCAGCTCCACTTCTCTCTCTCTCTCTGTCGATGCTTTCCTCCGGCG...

CDS

Download CDS FASTA

438 bp · TkA02G300680|TK1151|CDS

CATTTCGTCCGGGTTTTTCCCATTCCGTACGGGTTTTTGCCATTCTGTCCGAGTTTTGGGCCTAACCTAAATTCATCCCGGCCCAATGTTAAAATAACCTATTGCCCGTTCACAGTTAGGATCGGAGGTGTTTTTGGGGATTTCTCTCTGGTTCGACGACATCGACCTCCAGCGACAGACAGGACGACGACCTCCACCACTCCAACGACCAGCTCCAGCTCCACTTCTCTCTCTCTCTCTGTCGATGCTTTCCTCCGGCG...

Protein

Download Protein FASTA

145 aa · TkA02G300680|TK1151|PROTEIN

HFVRVFPIPYGFLPFCPSFGPNLNSSRPNVKITYCPFTVRIGGVFGDFSLVRRHRPPATDRTTTSTTPTTSSSSTSLSLSVDAFLRRRLPVKDSGSGIKKQDIQHIFTKFSEPRSASNRTTSTGAGLGLAIYKKFVSMMGGHIWI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G300680`
TK1151 ID	TkA02G300680
OH-1004 ID	LXL04_026423
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	55.200
Protein coverage (%)	TK1151 40.000 / OH-1004 7.560 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G300680

Location Chr02:76638578-76645494 (-)

Description Similar to ETR1: Ethylene receptor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40940`	Ethylene receptor related to bacterial two-component regulators.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XL32`	Ethylene receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os03g0701700`	Ethylene receptor related to bacterial two-component regulators.	No verified direct reference in this release
`UniProt: B8AY75`	Ethylene receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os05g0155200`	Ethylene receptor related to bacterial two-component regulators.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026423 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010105 negative regulation of ethylene-activated signaling pathway Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0000155 phosphorelay sensor kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0038199 ethylene receptor activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051740 ethylene binding Molecular Function

KEGG gene cross-reference

mdm:103401284

sly:606298

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.350

Rank 1 · TkA02G300680 · TK1151

Cytoplasm0.331

Rank 2 · TkA02G300680 · TK1151

Mitochondrion0.189

Rank 3 · TkA02G300680 · TK1151

Endoplasmic reticulum0.089

Rank 4 · TkA02G300680 · TK1151

Cell membrane0.082

Rank 5 · TkA02G300680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13589HATPase_c_371-129 aa

PF02518HATPase_c78-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G300680	`PF13589`	HATPase_c_3	71	129	0.012	16.3
TkA02G300680	`PF02518`	HATPase_c	78	145	3.7e-13	50.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38846`	Arabidopsis thaliana	sp\|Q38846\|ERS1_ARATH Ethylene response sensor 1	56.400%	Swiss-Prot	Low
`A2XL32`	Oryza sativa subsp. indica	sp\|A2XL32\|ERS1_ORYSI Probable ethylene response sensor 1	51.700%	Swiss-Prot	Low
`Q53RH0`	Oryza sativa subsp. japonica	sp\|Q53RH0\|ERS1_ORYSJ Probable ethylene response sensor 1	51.700%	Swiss-Prot	Low
`B8AY75`	Oryza sativa subsp. indica	sp\|B8AY75\|ERS2_ORYSI Probable ethylene response sensor 2	45.300%	Swiss-Prot	Low
`Q0DKM0`	Oryza sativa subsp. japonica	sp\|Q0DKM0\|ERS2_ORYSJ Probable ethylene response sensor 2	45.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card