TkA02G292520 | RubberDandelionOmics

Gene overview

TkA02G292520

Reference: TK1151 Chr: Chr02 Coordinates: 74666769-74667637 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

754 bp · TkA02G292520|TK1151|cDNA

AATCACAGTAATCATCATATGGGGTGTGATGATAATGACGGTGGTCTTGAATTGGGGCTAGGATTGAGTATTGGTAGTGGTTTAAAGACGAAGGAAGAAGATTCTTGTTCATCATCTTCATCATCGTCTTCTTTTGTCAATATCCCCAATTCCCCCATTGTTGGTACCAACAAAGCTCCGGTTGACTCTGTTTCACCTCCTAATGCTACCAGTCTGGTTGGATGGCCGCCGATAACACGAGCTAACCGGAATCCAATCGT...

CDS

Download CDS FASTA

663 bp · TkA02G292520|TK1151|CDS

ATGGGGTGTGATGATAATGACGGTGGTCTTGAATTGGGGCTAGGATTGAGTATTGGTAGTGGTTTAAAGACGAAGGAAGAAGATTCTTGTTCATCATCTTCATCATCGTCTTCTTTTGTCAATATCCCCAATTCCCCCATTGTTGGTACCAACAAAGCTCCGGTTGACTCTGTTTCACCTCCTAATGCTACCAGTCTGGTTGGATGGCCGCCGATAACACGAGCTAACCGGAATCCAATCGTGGCTCACCGGATTAAGCC...

Protein

Download Protein FASTA

220 aa · TkA02G292520|TK1151|PROTEIN

MGCDDNDGGLELGLGLSIGSGLKTKEEDSCSSSSSSSSFVNIPNSPIVGTNKAPVDSVSPPNATSLVGWPPITRANRNPIVAHRIKPEHDDFISRPVNNNRINDNGYLSVKVNMDGTLIGRKVNLNAHISYETLSQTLENMFHGSRKQAKIAGFGVSRILAQKMDPCNSSVGTIAYMSRERINTGHIWLAKRHNLYIIIRTRTEKTQVPLTLGLLTDLFD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G292520`
TK1151 ID	TkA02G292520
OH-1004 ID	LXL04_018712
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.000
Protein coverage (%)	TK1151 68.636 / OH-1004 57.795 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G292520

Location Chr02:74666769-74667637 (-)

Description Similar to IAA13: Auxin-responsive protein IAA13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21220`	Mitogen-activated protein kinase kinase (MAPKK) which regulates abscisic acid (ABA) responses in a MAPKKK20-MKK5-MPK6 cascade involved in root growth (e.g. root cell division and elongation) and stomatal response, probably via MAPK6 activation by protein phosphorylation.	Cell death mediated by MAPK is associated with hydrogen peroxide production in Arabidopsis.2002 · DOI: 10.1074/jbc.m109495200 MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048298 Ethylene signaling is required for the acceleration of cell death induced by the activation of AtMEK5 in Arabidopsis.2008 · DOI: 10.1038/cr.2008.29 Regulation of floral organ abscission in Arabidopsis thaliana.2008 · DOI: 10.1073/pnas.0805539105 A Pseudomonas syringae ADP-ribosyltransferase inhibits Arabidopsis mitogen-activated protein kinase kinases.2010 · DOI: 10.1105/tpc.110.075697 A MAPK cascade downstream of ERECTA receptor-like protein kinase regulates Arabidopsis inflorescence architecture by promoting localized cell proliferation.2012 · DOI: 10.1105/tpc.112.104695 Brassinosteroid-regulated GSK3/Shaggy-like kinases phosphorylate mitogen-activated protein (MAP) kinase kinases, which control stomata development in Arabidopsis thaliana.2013 · DOI: 10.1074/jbc.m112.384453 MKK5 regulates high light-induced gene expression of Cu/Zn superoxide dismutase 1 and 2 in Arabidopsis.2013 · DOI: 10.1093/pcp/pct072 Identification of BZR1-interacting proteins as potential components of the brassinosteroid signaling pathway in Arabidopsis through tandem affinity purification.2013 · DOI: 10.1074/mcp.m113.029256 AIK1, A Mitogen-Activated Protein Kinase, Modulates Abscisic Acid Responses through the MKK5-MPK6 Kinase Cascade.2017 · DOI: 10.1104/pp.16.01386
`At1g51660`	Involved in the second phase of hydrogen peroxide generation during hypersensitive response-like cell death.	MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048298 Regulation of floral organ abscission in Arabidopsis thaliana.2008 · DOI: 10.1073/pnas.0805539105 Arabidopsis MKK4 mediates osmotic-stress response via its regulation of MPK3 activity.2011 · DOI: 10.1016/j.bbrc.2011.07.064 A MAPK cascade downstream of ERECTA receptor-like protein kinase regulates Arabidopsis inflorescence architecture by promoting localized cell proliferation.2012 · DOI: 10.1105/tpc.112.104695 Brassinosteroid-regulated GSK3/Shaggy-like kinases phosphorylate mitogen-activated protein (MAP) kinase kinases, which control stomata development in Arabidopsis thaliana.2013 · DOI: 10.1074/jbc.m112.384453
`At2g33310`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At4g28640`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0355300`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018712 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G04550

ath:AT2G33310

ath:AT4G28640

dosa:Os02g0817600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.664

Rank 1 · TkA02G292520 · TK1151

Cytoplasm0.291

Rank 2 · TkA02G292520 · TK1151

Cell membrane0.108

Rank 3 · TkA02G292520 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA02G292520 · TK1151

Plastid0.035

Rank 5 · TkA02G292520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02309AUX_IAA52-147 aa

PF20011fvmJAB_N86-156 aa

PF00069Pkinase139-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G292520	`PF02309`	AUX_IAA	52	147	3.1e-19	70.4
TkA02G292520	`PF20011`	fvmJAB_N	86	156	0.11	13.1
TkA02G292520	`PF00069`	Pkinase	139	184	0.0012	19.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXG3`	Arabidopsis thaliana	sp\|Q8RXG3\|M2K5_ARATH Mitogen-activated protein kinase kinase 5	77.800%	Swiss-Prot	Low
`O80397`	Arabidopsis thaliana	sp\|O80397\|M2K4_ARATH Mitogen-activated protein kinase kinase 4	77.800%	Swiss-Prot	Low
`Q38831`	Arabidopsis thaliana	sp\|Q38831\|IAA13_ARATH Auxin-responsive protein IAA13	43.900%	Swiss-Prot	Low
`Q38829`	Arabidopsis thaliana	sp\|Q38829\|IAA11_ARATH Auxin-responsive protein IAA11	42.300%	Swiss-Prot	Low
`Q69TU6`	Oryza sativa subsp. japonica	sp\|Q69TU6\|IAA22_ORYSJ Auxin-responsive protein IAA22	38.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card