Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3329 bp · TkA02G289740|TK1151|cDNA
CTAACCGTTAAAACAAGAATTATTGGAGAAATCACTACCACTCCTTACACCTCCGCCACCTTCTTGTCCCTGTCCCACCCGGCCACCCCAACCCCGATCCTCTATGAAATCTGTCATTTTTCTTCGTCTTCATCTTCTTTTTCGTTCAAGAATCAACTATCAAGCTCATTTTTTAATCTATGGTACATGGGTTCTCTGAGCGAGCTTTTAGCCAAAGAAGGATTCGTACGAGATAATTCTAATCAGAAAAAGGTCCGATT...
2541 bp · TkA02G289740|TK1151|CDS
CTAACCGTTAAAACAAGAATTATTGGAGAAATCACTACCACTCCTTACACCTCCGCCACCTTCTTGTCCCTGTCCCACCCGGCCACCCCAACCCCGATCCTCTATGAAATCTGTCATTTTTCTTCGTCTTCATCTTCTTTTTCGTTCAAGAATCAACTATCAAGCTCATTTTTTAATCTATGGTACATGGGTTCTCTGAGCGAGCTTTTAGCCAAAGAAGGATTCGTACGAGATAATTCTAATCAGAAAAAGGTCCGATT...
Protein
Download Protein FASTA846 aa · TkA02G289740|TK1151|PROTEIN
LTVKTRIIGEITTTPYTSATFLSLSHPATPTPILYEICHFSSSSSSFSFKNQLSSSFFNLWYMGSLSELLAKEGFVRDNSNQKKVRFNRTVAAPDHDSISLPIYICRDRKSIDVPKHKKTSSGVSSKSRRSSVSRRSDEPAIDEVATKAVISILSGYAGKYLKDKDFRDSLRDKCSSCLVRRSNGLSDNGVFANMELGIESIEKLIDNPGTIKELKMKSLRNSIGFLTIVAALNSKESRNGTTCGTPNSHLSACAQLYLS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G289740 |
|---|---|
| TK1151 ID | TkA02G289740 |
| OH-1004 ID | LXL04_015758 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 89.716 / OH-1004 73.858Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G289740 |
|---|---|
| Location | Chr02:74031400-74035307 (-) |
| Description | Similar to LIN: Putative E3 ubiquitin-protein ligase LIN-2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009877 nodulation Biological Process GO:0016567 protein ubiquitination Biological Process GO:0061630 ubiquitin protein ligase activity Molecular Function |
| KEGG gene cross-reference | mtr:11418360 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02455Hex_IIIa106-170 aaPF23568ARM_LIN145-373 aaPF23654ARM_LIN_2nd321-350 aaPF02455Hex_IIIa422-498 aaPF23628ARM_LIN_C465-554 aaPF23654ARM_LIN_2nd480-638 aaPF23628ARM_LIN_C640-780 aaPF23568ARM_LIN720-749 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G289740 | PF02455 | Hex_IIIa | 106 | 170 | 0.0065 | 16.0 |
| TkA02G289740 | PF23568 | ARM_LIN | 145 | 373 | 5.2e-103 | 344.0 |
| TkA02G289740 | PF23654 | ARM_LIN_2nd | 321 | 350 | 9.5e-51 | 172.4 |
| TkA02G289740 | PF02455 | Hex_IIIa | 422 | 498 | 0.0065 | 16.0 |
| TkA02G289740 | PF23628 | ARM_LIN_C | 465 | 554 | 1.7e-40 | 139.9 |
| TkA02G289740 | PF23654 | ARM_LIN_2nd | 480 | 638 | 9.5e-51 | 172.4 |
| TkA02G289740 | PF23628 | ARM_LIN_C | 640 | 780 | 1.7e-40 | 139.9 |
| TkA02G289740 | PF23568 | ARM_LIN | 720 | 749 | 5.2e-103 | 344.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.