TkA02G281280 | RubberDandelionOmics

Gene overview

TkA02G281280

Reference: TK1151 Chr: Chr02 Coordinates: 71790966-71792868 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1812 bp · TkA02G281280|TK1151|cDNA

GTGCAGTTCGTCATGGGTGAAAGCAGCGAGTCTGTGTTGCTTATATTGGAAGATGGACAGAGTCAACGTAAAATTGCCCAGAAACGTATTAAACTTCACGATATGACGGAGAAGGGGGAAGAGGATGTAATCAGTGCCCTGCCGGATTGCTTACTTGTCGAAATCCTGTCTCGTTTACCGTCCACCAAGGACGCCATTAGAACAGGTACCCTCTCCAAGCGATGGCAACATATTTGGCCTTGGGTACCTACTCTGGTTTT...

CDS

Download CDS FASTA

1248 bp · TkA02G281280|TK1151|CDS

ATGGGTGAAAGCAGCGAGTCTGTGTTGCTTATATTGGAAGATGGACAGAGTCAACGTAAAATTGCCCAGAAACGTATTAAACTTCACGATATGACGGAGAAGGGGGAAGAGGATGTAATCAGTGCCCTGCCGGATTGCTTACTTGTCGAAATCCTGTCTCGTTTACCGTCCACCAAGGACGCCATTAGAACAGGTACCCTCTCCAAGCGATGGCAACATATTTGGCCTTGGGTACCTACTCTGGTTTTTACACCTTCAGA...

Protein

Download Protein FASTA

415 aa · TkA02G281280|TK1151|PROTEIN

MGESSESVLLILEDGQSQRKIAQKRIKLHDMTEKGEEDVISALPDCLLVEILSRLPSTKDAIRTGTLSKRWQHIWPWVPTLVFTPSDHRPKQCPQNSNPMSDHALLVDKTLGQCRQSNLKKFEVRTWYDTRFESRYRDWIRYAISRNVENLNLNVLGTEAGFVLDQSIFINSCFTDVRLSGCKLSPTRAISWGNLRRLCLSRVNVDHDLIVNIVSGSPLLKTLVLHCCEWPNITSESESESESEDHIIPPTSLSLTQCRQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G281280`
TK1151 ID	TkA02G281280
OH-1004 ID	LXL04_031291
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.000
Protein coverage (%)	TK1151 93.012 / OH-1004 43.959 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G281280

Location Chr02:71790966-71792868 (+)

Description Similar to At5g03100: F-box protein At5g03100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03360`	F-box/LRR-repeat protein At3g03360.	No verified direct reference in this release
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release
`At3g18150`	Putative F-box/LRR-repeat protein At3g18150.	No verified direct reference in this release
`At2g42730`	F-box/LRR-repeat protein At2g42730.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031291 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.751

Rank 1 · TkA02G281280 · TK1151

Cytoplasm0.291

Rank 2 · TkA02G281280 · TK1151

Cell membrane0.054

Rank 3 · TkA02G281280 · TK1151

Endoplasmic reticulum0.047

Rank 4 · TkA02G281280 · TK1151

Mitochondrion0.023

Rank 5 · TkA02G281280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box40-78 aa

PF12937F-box-like40-74 aa

PF07723LRR_245-56 aa

PF23622LRR_At1g61320_AtMIF1119-229 aa

PF24758LRR_At5g56370137-237 aa

PF00805Pentapeptide161-185 aa

PF00805Pentapeptide194-204 aa

PF07723LRR_2195-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G281280	`PF00646`	F-box	40	78	5.4e-05	23.6
TkA02G281280	`PF12937`	F-box-like	40	74	0.00027	21.4
TkA02G281280	`PF07723`	LRR_2	45	56	0.0013	19.9
TkA02G281280	`PF23622`	LRR_At1g61320_AtMIF1	119	229	3.1e-16	60.5
TkA02G281280	`PF24758`	LRR_At5g56370	137	237	3e-17	63.8
TkA02G281280	`PF00805`	Pentapeptide	161	185	0.26	11.6
TkA02G281280	`PF00805`	Pentapeptide	194	204	0.26	11.6
TkA02G281280	`PF07723`	LRR_2	195	218	0.0013	19.9
TkA02G281280	`PF07723`	LRR_2	220	232	0.0013	19.9
TkA02G281280	`PF23622`	LRR_At1g61320_AtMIF1	275	383	3.1e-16	60.5
TkA02G281280	`PF24758`	LRR_At5g56370	295	392	3e-17	63.8
TkA02G281280	`PF00805`	Pentapeptide	314	327	0.26	11.6
TkA02G281280	`PF07723`	LRR_2	339	364	0.0013	19.9
TkA02G281280	`PF00646`	F-box	350	361	5.4e-05	23.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W80`	Arabidopsis thaliana	sp\|Q84W80\|FBL42_ARATH F-box/LRR-repeat protein At3g03360	33.000%	Swiss-Prot	Low
`Q9FX89`	Arabidopsis thaliana	sp\|Q9FX89\|FB50_ARATH Putative F-box protein At1g49610	34.900%	Swiss-Prot	Low
`Q9LV26`	Arabidopsis thaliana	sp\|Q9LV26\|FBL45_ARATH Putative F-box/LRR-repeat protein At3g18150	31.700%	Swiss-Prot	Low
`Q0WR05`	Arabidopsis thaliana	sp\|Q0WR05\|FBL39_ARATH F-box/LRR-repeat protein At2g42730	30.000%	Swiss-Prot	Low
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	33.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card