RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G277700
Reference: TK1151 Chr: Chr02 Coordinates: 70898189-70903193 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3539 bp · TkA02G277700|TK1151|cDNA

TGAAAAGCTAGAATATAAGTGTTGCCTTGTTCATATACACAACTCTACATACCCTCATTCTTCAGCTTCTTCGACTTCTGCTCTTTTTATTACTTGTTCTTCGCAATCGTGCAATCAACGTGGAATCAACACCAAATAGTTCCGTCTTTAGAGATGGAATCTAAGCTGGATTGTGATGCGGATCAAGGTCATGATCCAAACAAAGGTTCCATGGCCAAGATAGAAGAGAATGGCAAGCGTCCAGTGGTATATATTTACAG...

CDS

Download CDS FASTA

3132 bp · TkA02G277700|TK1151|CDS

ATGGAATCTAAGCTGGATTGTGATGCGGATCAAGGTCATGATCCAAACAAAGGTTCCATGGCCAAGATAGAAGAGAATGGCAAGCGTCCAGTGGTATATATTTACAGACAAGATGTTGTAAAGAGCAAAATTGATGGTAAAACAGGGGTAGTGACAGAAGTTGCAGGTGATTCTGATTCAGATAGCAGTACCAGTGATGATGATGAAGATGAAGATGAAGAGAATGAAGACACTGAAACAGCGGGTCCCACTGAAGATGG...

Protein

Download Protein FASTA

1043 aa · TkA02G277700|TK1151|PROTEIN

MESKLDCDADQGHDPNKGSMAKIEENGKRPVVYIYRQDVVKSKIDGKTGVVTEVAGDSDSDSSTSDDDEDEDEENEDTETAGPTEDGSQDLNENITGNNTDNENDDEETTPLPADHVRVFWMDESQSTQSQNDVIVIDRGFLHGDYVASVSDPTGQVGVVVDVSISVDLSTIEGSVINDISSKILKRVRDFQVGDYVILGPWLGRIDDVLDNVTVMFDDGSVCKVMKADPIQLKPVSKNNNNNNNNNLLEDSHYPYYPGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G277700
TK1151 IDTkA02G277700
OH-1004 IDLXL04_015997
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.100
Protein coverage (%)TK1151 98.849 / OH-1004 96.695
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G277700
LocationChr02:70898189-70903193 (+)
DescriptionSimilar to UBC23: Probable ubiquitin-conjugating enzyme E2 23
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g16920 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. No verified direct reference in this release
At2g33770 E2 ubiquitin-protein ligase that mediates E1-dependent protein ubiquitination.
PHO2-dependent degradation of PHO1 modulates phosphate homeostasis in Arabidopsis.2012 · DOI: 10.1105/tpc.112.096636
Nitrogen limitation adaptation, a target of microRNA827, mediates degradation of plasma membrane-localized phosphate transporters to maintain phosphate homeostasis in Arabidopsis.2013 · DOI: 10.1105/tpc.113.116012
Identification of downstream components of ubiquitin-conjugating enzyme PHOSPHATE2 by quantitative membrane proteomics in Arabidopsis roots.2013 · DOI: 10.1105/tpc.113.115998
NITROGEN LIMITATION ADAPTATION recruits PHOSPHATE2 to target the phosphate transporter PT2 for degradation during the regulation of Arabidopsis phosphate homeostasis.2014 · DOI: 10.1105/tpc.113.120311
At3g15355 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. No verified direct reference in this release
At1g53025 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. No verified direct reference in this release
At1g53020 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015997 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006817 phosphate ion transport Biological Process
GO:0016036 cellular response to phosphate starvation Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0055062 phosphate ion homeostasis Biological Process
GO:2000185 regulation of phosphate transmembrane transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005524 ATP binding Molecular Function
GO:0016874 ligase activity Molecular Function
KEGG gene cross-reference
ath:AT1G53025
ath:AT2G16920
ath:AT2G33770
ath:AT3G15355
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529
Rank 1 · TkA02G277700 · TK1151
Nucleus0.383
Rank 2 · TkA02G277700 · TK1151
Cell membrane0.132
Rank 3 · TkA02G277700 · TK1151
Golgi apparatus0.090
Rank 4 · TkA02G277700 · TK1151
Lysosome / Vacuole0.088
Rank 5 · TkA02G277700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23048SH3-A_UBE2O34-133 aa
PF23044SH3-C_UBE2O116-137 aa
PF23043SH3-B_UBE2O140-163 aa
PF23046tSH3-B_UBE2O193-332 aa
PF23044SH3-C_UBE2O287-302 aa
PF23048SH3-A_UBE2O358-407 aa
PF23044SH3-C_UBE2O407-444 aa
PF23046tSH3-B_UBE2O429-444 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G277700PF23048SH3-A_UBE2O341332.2e-0938.6
TkA02G277700PF23044SH3-C_UBE2O1161371e-0938.9
TkA02G277700PF23043SH3-B_UBE2O1401631.9e-1764.1
TkA02G277700PF23046tSH3-B_UBE2O1933324.8e-44150.1
TkA02G277700PF23044SH3-C_UBE2O2873021e-0938.9
TkA02G277700PF23048SH3-A_UBE2O3584072.2e-0938.6
TkA02G277700PF23044SH3-C_UBE2O4074441e-0938.9
TkA02G277700PF23046tSH3-B_UBE2O4294444.8e-44150.1
TkA02G277700PF23043SH3-B_UBE2O4615411.9e-1764.1
TkA02G277700PF23048SH3-A_UBE2O4755052.2e-0938.6
TkA02G277700PF23044SH3-C_UBE2O5426161e-0938.9
TkA02G277700PF23048SH3-A_UBE2O5595952.2e-0938.6
TkA02G277700PF23048SH3-A_UBE2O6126282.2e-0938.6
TkA02G277700PF23048SH3-A_UBE2O7057162.2e-0938.6
TkA02G277700PF00179UQ_con7969261.1e-1971.2
TkA02G277700PF05743UEV8459170.01715.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZVX1Arabidopsis thalianasp|Q9ZVX1|UBC23_ARATH Probable ubiquitin-conjugating enzyme E2 2358.000%Swiss-ProtHigh
Q8VY10Arabidopsis thalianasp|Q8VY10|UBC24_ARATH Probable ubiquitin-conjugating enzyme E2 2438.600%Swiss-ProtMedium
Q9LUQ5Arabidopsis thalianasp|Q9LUQ5|UBC25_ARATH Probable ubiquitin-conjugating enzyme E2 2552.500%Swiss-ProtLow
Q8GY87Arabidopsis thalianasp|Q8GY87|UBC26_ARATH Probable ubiquitin-conjugating enzyme E2 2650.600%Swiss-ProtLow
Q9C918Arabidopsis thalianasp|Q9C918|UBC38_ARATH Putative ubiquitin-conjugating enzyme E2 3850.200%Swiss-ProtLow

JBrowse

View in Genome Browser