Gene Card
Gene overview
cDNA / CDS / Protein Sequences
945 bp · TkA02G264730|TK1151|cDNA
ATGGGTGGAGGTAGGGTGGCTCATCCGGTGTTGAAAGGGCCTAGTGTGGTGAAGGAGCTGGTGATTGGGGCGGTGCTAGGGTTAGCCGCTGGCGGCTTATGGAAGATGCACCACTGGAATGAGCAGAGAAAAACTAGGGCTTTTTATGACTTATTGGAGAAGGGAAGTAGAAAAATGGCGGATGATGTAACGAGATGGTCGGTGACCTACACGAAGCACATAAAGCAGAAGCGTAAAGTTTATGAAGACGGATTTTTAGA...
945 bp · TkA02G264730|TK1151|CDS
ATGGGTGGAGGTAGGGTGGCTCATCCGGTGTTGAAAGGGCCTAGTGTGGTGAAGGAGCTGGTGATTGGGGCGGTGCTAGGGTTAGCCGCTGGCGGCTTATGGAAGATGCACCACTGGAATGAGCAGAGAAAAACTAGGGCTTTTTATGACTTATTGGAGAAGGGAAGTAGAAAAATGGCGGATGATGTAACGAGATGGTCGGTGACCTACACGAAGCACATAAAGCAGAAGCGTAAAGTTTATGAAGACGGATTTTTAGA...
Protein
Download Protein FASTA314 aa · TkA02G264730|TK1151|PROTEIN
MGGGRVAHPVLKGPSVVKELVIGAVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGSRKMADDVTRWSVTYTKHIKQKRKVYEDGFLEVQSSSHKVKLYDDCDKLLDSKIVKLDDDAVKSGETITFGSYLVDIGDPQGDIKPIPNIILQRDKIIADKTHMSNTKTSKVSSRVGKTSSINLSPSQKIIREFKRREVKKYSSPPSCQTTTKDESTEWEVLYTAQLTQKAKKFHDGILKVAISGLRGRQAILYDETRKQLDSKF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G264730 |
|---|---|
| TK1151 ID | TkA02G264730 |
| OH-1004 ID | LXL04_029497 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 99.682 / OH-1004 57.117Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G264730 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:67796295-67800464 (-) | ||||||||||||
| Description | Similar to COX5C2: Cytochrome c oxidase subunit 5C-2 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT3G62400 dosa:Os12g0561000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF30944COX5C23-47 aaPF08706D5_N34-115 aaPF10382ZGRF1-like_N63-137 aaPF26323EsxC63-123 aaPF26018BSH_RND_rel81-123 aaPF21544PorZ_N_b_propeller88-157 aaPF10382ZGRF1-like_N213-289 aaPF26018BSH_RND_rel226-226 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G264730 | PF30944 | COX5C | 23 | 47 | 1.9e-16 | 60.0 |
| TkA02G264730 | PF08706 | D5_N | 34 | 115 | 0.091 | 13.8 |
| TkA02G264730 | PF10382 | ZGRF1-like_N | 63 | 137 | 1.2e-32 | 112.7 |
| TkA02G264730 | PF26323 | EsxC | 63 | 123 | 0.79 | 10.9 |
| TkA02G264730 | PF26018 | BSH_RND_rel | 81 | 123 | 0.27 | 11.8 |
| TkA02G264730 | PF21544 | PorZ_N_b_propeller | 88 | 157 | 0.17 | 12.8 |
| TkA02G264730 | PF10382 | ZGRF1-like_N | 213 | 289 | 1.2e-32 | 112.7 |
| TkA02G264730 | PF26018 | BSH_RND_rel | 226 | 226 | 0.27 | 11.8 |
| TkA02G264730 | PF26323 | EsxC | 243 | 267 | 0.79 | 10.9 |
| TkA02G264730 | PF22523 | DUF6999 | 260 | 309 | 0.19 | 11.4 |
| TkA02G264730 | PF21544 | PorZ_N_b_propeller | 275 | 306 | 0.17 | 12.8 |
| TkA02G264730 | PF26323 | EsxC | 292 | 312 | 0.79 | 10.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.