TkA02G264710 | RubberDandelionOmics

Gene overview

TkA02G264710

Reference: TK1151 Chr: Chr02 Coordinates: 67793997-67795542 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

996 bp · TkA02G264710|TK1151|cDNA

TTTAAACTGAATCACAACTTCTTCATAAGATGCCACTAATCCTAAATATGATGAAGGGTAAAAATGAAAATTATTTTCATGAACCAACTAAATATGATGAAGGTCTCTTTACTGATGCTCTCAAGGACTTGAGAAATGTGAAACAGCAATTATATTCAGCTGCCGAGCATTTTGAAGACTCATATTACAAGAATGATGGGAAACAAATGTTGTTAGAAAGCTTAAAGGACTACATTTCCAAATCTCTCATTAAAACCATC...

CDS

Download CDS FASTA

714 bp · TkA02G264710|TK1151|CDS

ATGCCACTAATCCTAAATATGATGAAGGGTAAAAATGAAAATTATTTTCATGAACCAACTAAATATGATGAAGGTCTCTTTACTGATGCTCTCAAGGACTTGAGAAATGTGAAACAGCAATTATATTCAGCTGCCGAGCATTTTGAAGACTCATATTACAAGAATGATGGGAAACAAATGTTGTTAGAAAGCTTAAAGGACTACATTTCCAAATCTCTCATTAAAACCATCGACCATTTGGGCTGTATCTCCTATAAACT...

Protein

Download Protein FASTA

237 aa · TkA02G264710|TK1151|PROTEIN

MPLILNMMKGKNENYFHEPTKYDEGLFTDALKDLRNVKQQLYSAAEHFEDSYYKNDGKQMLLESLKDYISKSLIKTIDHLGCISYKLDNFLHHNLNQLSSINLQVVCIEQRLQTCEAYANNVGLSQQSVTTETPKYRTKYIVPVIATECRETKSSGVRKWYGEEASSEFPRGSVDFSFTKASLKKRLEKRSRSMSPLHFRSPNIWRKKDMEVVYPKKTTNLFKLLLTMYKSKNNNAY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G264710`
TK1151 ID	TkA02G264710
OH-1004 ID	LXL04_029498
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G264710

Location Chr02:67793997-67795542 (+)

Description Similar to ABIL2: Protein ABIL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49290`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release
`At5g24310`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release
`At5g42030`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release
`At2g46225`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0236400`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029498 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010090 trichome morphogenesis Biological Process

GO:0048364 root development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

KEGG gene cross-reference

ath:AT3G49290

ath:AT5G24310

dosa:Os01g0236400

dosa:Os01g0622700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.516

Rank 1 · TkA02G264710 · TK1151

Cytoplasm0.443

Rank 2 · TkA02G264710 · TK1151

Cell membrane0.098

Rank 3 · TkA02G264710 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA02G264710 · TK1151

Lysosome / Vacuole0.033

Rank 5 · TkA02G264710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27594ABI28-92 aa

PF00523Fusion_gly61-87 aa

PF27594ABI125-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G264710	`PF27594`	ABI	28	92	1.7e-09	38.3
TkA02G264710	`PF00523`	Fusion_gly	61	87	0.055	12.5
TkA02G264710	`PF27594`	ABI	125	139	1.7e-09	38.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3A3`	Arabidopsis thaliana	sp\|Q9M3A3\|ABIL2_ARATH Protein ABIL2	47.400%	Swiss-Prot	Medium
`Q6NMC6`	Arabidopsis thaliana	sp\|Q6NMC6\|ABIL3_ARATH Protein ABIL3	45.500%	Swiss-Prot	Medium
`Q9FHY1`	Arabidopsis thaliana	sp\|Q9FHY1\|ABIL4_ARATH Protein ABIL4	36.800%	Swiss-Prot	Medium
`Q8S8M5`	Arabidopsis thaliana	sp\|Q8S8M5\|ABIL1_ARATH Protein ABIL1	39.300%	Swiss-Prot	Low
`Q5NB83`	Oryza sativa subsp. japonica	sp\|Q5NB83\|ABIL3_ORYSJ Probable protein ABIL3	44.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card