TkA02G263770 | RubberDandelionOmics

Gene overview

TkA02G263770

Reference: TK1151 Chr: Chr02 Coordinates: 67524952-67527680 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1998 bp · TkA02G263770|TK1151|cDNA

TTACAATCGAAAAAACAGAGTAAACTTCTCCTGTCCACTCTTACGTAAATCTTCAACTTTCATGAGAGATGAAGAAACCCATCATCCAAAATCCATCTACACATCTCCAATGTCACCCCAATAACCTAAAATTATTCATCAAAAAAGATGAAAAAGACAGCTTTTTAAAGCTCTCGTTGCCTTTATTTATCACATTTTGGCTCCCGTTTATGATTTCCTTCTCAACGTTTGGCCTCAATCACGGCAATGGAGGTAATATT...

CDS

Download CDS FASTA

1707 bp · TkA02G263770|TK1151|CDS

ATGAAGAAACCCATCATCCAAAATCCATCTACACATCTCCAATGTCACCCCAATAACCTAAAATTATTCATCAAAAAAGATGAAAAAGACAGCTTTTTAAAGCTCTCGTTGCCTTTATTTATCACATTTTGGCTCCCGTTTATGATTTCCTTCTCAACGTTTGGCCTCAATCACGGCAATGGAGGTAATATTGGAGGTGTTTTTAGCAAGAATAACACCAATATGAGCTCATATCCATACCTCGAAGATCAAGGTCGAAA...

Protein

Download Protein FASTA

568 aa · TkA02G263770|TK1151|PROTEIN

MKKPIIQNPSTHLQCHPNNLKLFIKKDEKDSFLKLSLPLFITFWLPFMISFSTFGLNHGNGGNIGGVFSKNNTNMSSYPYLEDQGRNHTDRVLLEFNISRVHNNSTSYEEETEGNPLEETTSANEAFWKALGYSTFVCERQIQHLYFENKQEDVKTGRTHLTYHDLNEVAGAASGLTNITHRLEPDGTKYNYAAASKGAKVVAHDKEAKGASNILGEDHDRYLRNPCSVPDKFVVIELAEETLIDAIMMANFEHYSSNFK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G263770`
TK1151 ID	TkA02G263770
OH-1004 ID	LXL04_029508
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G263770

Location Chr02:67524952-67527680 (+)

Description Similar to SUN5: SUN domain-containing protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23950`	Encodes a member of the mid-SUN subfamily of SUN-domain proteins.	No verified direct reference in this release
`At1g22882`	Encodes a member of the mid-SUN subfamily of SUN-domain proteins that is localized to both the nuclear envelope and the ER.	No verified direct reference in this release
`At1g71360`	Encodes a member of the mid-SUN subfamily of SUN-domain proteins that is localized to both the nuclear envelope and the ER.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029508 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006997 nucleus organization Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0034975 protein folding in endoplasmic reticulum Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT1G22882

ath:AT1G71360

ath:AT4G23950

ddi:DDB_G0285925

spo:2540275

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.546

Rank 1 · TkA02G263770 · TK1151

Golgi apparatus0.353

Rank 2 · TkA02G263770 · TK1151

Nucleus0.091

Rank 3 · TkA02G263770 · TK1151

Cytoplasm0.085

Rank 4 · TkA02G263770 · TK1151

Cell membrane0.071

Rank 5 · TkA02G263770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15159PIG-Y37-49 aa

PF30358GOLM116-153 aa

PF07738Sad1_UNC205-327 aa

PF00754F5_F8_type_C230-310 aa

PF21484Chp1-like_PIN234-264 aa

PF30358GOLM400-454 aa

PF21484Chp1-like_PIN442-505 aa

PF15159PIG-Y509-564 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G263770	`PF15159`	PIG-Y	37	49	0.016	16.8
TkA02G263770	`PF30358`	GOLM	116	153	0.11	12.8
TkA02G263770	`PF07738`	Sad1_UNC	205	327	7.1e-30	104.5
TkA02G263770	`PF00754`	F5_F8_type_C	230	310	0.0011	19.9
TkA02G263770	`PF21484`	Chp1-like_PIN	234	264	0.16	12.6
TkA02G263770	`PF30358`	GOLM	400	454	0.11	12.8
TkA02G263770	`PF21484`	Chp1-like_PIN	442	505	0.16	12.6
TkA02G263770	`PF15159`	PIG-Y	509	564	0.016	16.8
TkA02G263770	`PF07738`	Sad1_UNC	517	530	7.1e-30	104.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JPE9`	Arabidopsis thaliana	sp\|F4JPE9\|SUN5_ARATH SUN domain-containing protein 5	44.900%	Swiss-Prot	Medium
`F4I316`	Arabidopsis thaliana	sp\|F4I316\|SUN3_ARATH SUN domain-containing protein 3	45.500%	Swiss-Prot	Low
`F4I8I0`	Arabidopsis thaliana	sp\|F4I8I0\|SUN4_ARATH SUN domain-containing protein 4	44.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card