TkA02G260330 | RubberDandelionOmics

Gene overview

TkA02G260330

Reference: TK1151 Chr: Chr02 Coordinates: 66403237-66404109 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

873 bp · TkA02G260330|TK1151|cDNA

ATGGAACAAGATGATTCCGGCAACATGGATAGAAAAGGCAAAGGAAAGATGACGGACGATTCTGATAAGGGTAATCCAATTGCTGTTCTTAAGGGTTCGTCATCTTCTTCCGTTCAAGAAAATGAATCTGCTCCGGCGGCCAATGTTCCCATCGCAACGACAGTGGCGGAGGAGCCCGTCTGTCCACCACCTGATTTGATACAACCGACGTCGTCAACCCCTAATCGAAGGCCGGCCCGCAGACTCTACCATTGCCAATT...

CDS

Download CDS FASTA

873 bp · TkA02G260330|TK1151|CDS

ATGGAACAAGATGATTCCGGCAACATGGATAGAAAAGGCAAAGGAAAGATGACGGACGATTCTGATAAGGGTAATCCAATTGCTGTTCTTAAGGGTTCGTCATCTTCTTCCGTTCAAGAAAATGAATCTGCTCCGGCGGCCAATGTTCCCATCGCAACGACAGTGGCGGAGGAGCCCGTCTGTCCACCACCTGATTTGATACAACCGACGTCGTCAACCCCTAATCGAAGGCCGGCCCGCAGACTCTACCATTGCCAATT...

Protein

Download Protein FASTA

290 aa · TkA02G260330|TK1151|PROTEIN

MEQDDSGNMDRKGKGKMTDDSDKGNPIAVLKGSSSSSVQENESAPAANVPIATTVAEEPVCPPPDLIQPTSSTPNRRPARRLYHCQFCEASAYELPWMQQHEERHRMNAALSQQIPEGMRPRRYYTWDTRPMMIPSLQYVLGAGLGYAYGGGGCSRAVTSQPLDDFNHYPPVAQAGRPPRPPFAQPGRPPRPPVAQAGLPPRPPVAQRGRPPRPPFAESGRPLQRRRLNTNLSLALPQAEPDTNDGSIDFLSRIGISRSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G260330`
TK1151 ID	TkA02G260330
OH-1004 ID	LXL04_029559
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	95.300
Protein coverage (%)	TK1151 91.034 / OH-1004 91.973 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G260330`
Location	Chr02:66403237-66404109 (-)
Description	Similar to CEL: Bile salt-activated lipase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029559` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0030157 pancreatic juice secretion Biological Process GO:0030299 intestinal cholesterol absorption Biological Process GO:0046514 ceramide catabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0005737 cytoplasm Cellular Component GO:0016020 membrane Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0003824 catalytic activity Molecular Function GO:0004771 sterol ester esterase activity Molecular Function GO:0004806 triacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	hsa:1056 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.858

Rank 1 · TkA02G260330 · TK1151

Cytoplasm0.274

Rank 2 · TkA02G260330 · TK1151

Mitochondrion0.024

Rank 3 · TkA02G260330 · TK1151

Cell membrane0.020

Rank 4 · TkA02G260330 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA02G260330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14052Caps_assemb_Wzi79-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G260330	`PF14052`	Caps_assemb_Wzi	79	154	0.26	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card