TkA02G251710 | RubberDandelionOmics

Gene overview

TkA02G251710

Reference: TK1151 Chr: Chr02 Coordinates: 64437693-64439674 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1304 bp · TkA02G251710|TK1151|cDNA

TTGCAGATTAAGATATGTAACGGAAAGTTATTTCAAGTAGTTGCATCCACAAAGGGCTTCTACGCCCTGGGAAAGCAGTTTTTGCAAAGCCATTCCCTGGTGGATCTTCTTCAACAGCTCAGTCAAGCTTTTGCTAACGCAGCATATGAATCCTTGATGAAAGCCTACCAAGAACATAACAAGTTTGGTAATCTTCCATATGGTTTTCGAGCAAACACCTGGTTAGTTCCTCCATCCATCCTAGATTCAGAATCAATCAA...

CDS

Download CDS FASTA

489 bp · TkA02G251710|TK1151|CDS

TTGCAGATTAAGATATGTAACGGAAAGTTATTTCAAGTAGTTGCATCCACAAAGGGCTTCTACGCCCTGGGAAAGCAGTTTTTGCAAAGCCATTCCCTGGTGGATCTTCTTCAACAGCTCAGTCAAGCTTTTGCTAACGCAGCATATGAATCCTTGATGAAAGCCTACCAAGAACATAACAAGTTTGGTAATCTTCCATATGGTTTTCGAGCAAACACCTGGTTAGTTCCTCCATCCATCCTAGATTCAGAATCAATCAA...

Protein

Download Protein FASTA

162 aa · TkA02G251710|TK1151|PROTEIN

LQIKICNGKLFQVVASTKGFYALGKQFLQSHSLVDLLQQLSQAFANAAYESLMKAYQEHNKFGNLPYGFRANTWLVPPSILDSESINNPLPSEDPTWGGNGGGQGQNGQHDHRPWATEFAILASLPCKTEEQRVIRDRKAFLIHSLFVDVSILNPFQPSAKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G251710`
TK1151 ID	TkA02G251710
OH-1004 ID	LXL04_003713
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 93.827 / OH-1004 40.318 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G251710

Location Chr02:64437693-64439674 (-)

Description Similar to TSS: Protein TSS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15290`	May act as the scaffold of a protein complex, which sequesters key factors that are required for the G2 to M transition in meristematic tissues (By similarity).	No verified direct reference in this release
`At4g28080`	Negatively regulates meristematic tissue proliferation by integrating developmental signals with carbon source availability.	No verified direct reference in this release
`At1g01320`	May act as the scaffold of a protein complex, which sequesters key factors that are required for the G2 to M transition in meristematic tissues (By similarity).	REDUCED CHLOROPLAST COVERAGE genes from Arabidopsis thaliana help to establish the size of the chloroplast compartment.2016 · DOI: 10.1073/pnas.1515741113

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003713 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007005 mitochondrion organization Biological Process

GO:0010906 regulation of glucose metabolic process Biological Process

GO:0019750 chloroplast localization Biological Process

GO:0048312 intracellular distribution of mitochondria Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ang:An02g06530

ath:AT1G01320

ath:AT1G15290

ath:AT4G28080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.436

Rank 1 · TkA02G251710 · TK1151

Nucleus0.434

Rank 2 · TkA02G251710 · TK1151

Mitochondrion0.129

Rank 3 · TkA02G251710 · TK1151

Cell membrane0.082

Rank 4 · TkA02G251710 · TK1151

Endoplasmic reticulum0.057

Rank 5 · TkA02G251710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HZK4`	Arabidopsis thaliana	sp\|F4HZK4\|REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3	65.800%	Swiss-Prot	High
`F4JKH6`	Arabidopsis thaliana	sp\|F4JKH6\|REC2_ARATH Protein REDUCED CHLOROPLAST COVERAGE 2	65.800%	Swiss-Prot	High
`F4HS99`	Arabidopsis thaliana	sp\|F4HS99\|REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1	55.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card