TkA02G224720 | RubberDandelionOmics

Gene overview

TkA02G224720

Reference: TK1151 Chr: Chr02 Coordinates: 58267138-58271055 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · TkA02G224720|TK1151|cDNA

ATGACTGGGGGACCAGGTTGTAGTAGCGAGCTTTCTCTTTTCTTTGAAAATGGTCCTATCAAAATCGGAGATAACCTGATTCTTGTCTGGAACGAGTATGGGTGGGACAAGAACAGCATAAGTCGAGGTCTCTCAGATAAAGAAAAGGGTAGCAGCGTCACAAAGATTAAAGTTGTGGTACGTAAGAGACCATTGAACAAAAACGAGTTAGCAAAAAACGAGGAAGATATCATTACTACTGAGAGCCGATCCAATTGCCT...

CDS

Download CDS FASTA

819 bp · TkA02G224720|TK1151|CDS

ATGACTGGGGGACCAGGTTGTAGTAGCGAGCTTTCTCTTTTCTTTGAAAATGGTCCTATCAAAATCGGAGATAACCTGATTCTTGTCTGGAACGAGTATGGGTGGGACAAGAACAGCATAAGTCGAGGTCTCTCAGATAAAGAAAAGGGTAGCAGCGTCACAAAGATTAAAGTTGTGGTACGTAAGAGACCATTGAACAAAAACGAGTTAGCAAAAAACGAGGAAGATATCATTACTACTGAGAGCCGATCCAATTGCCT...

Protein

Download Protein FASTA

272 aa · TkA02G224720|TK1151|PROTEIN

MTGGPGCSSELSLFFENGPIKIGDNLILVWNEYGWDKNSISRGLSDKEKGSSVTKIKVVVRKRPLNKNELAKNEEDIITTESRSNCLAVHETKLKVDLTEYMEKHEFVFDAVLNEEVSNDEGLNEGKNLYELKTGEMKGTGKMKVQVNRRGLRIRMIWSYDSRVTAKTLNRGQDVKNPSCKSYGQNTEQAIPDPTRNPTRTQPENKRVWVLISDPPTRQPANLLISRVGFGLRFQVNGYETGSRTDPEFAGKTIRVDAEF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G224720`
TK1151 ID	TkA02G224720
OH-1004 ID	LXL04_008482
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.100
Protein coverage (%)	TK1151 32.721 / OH-1004 14.105 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G224720

Location Chr02:58267138-58271055 (-)

Description Similar to KIN13B: Kinesin-like protein KIN-13B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16060`	Acts redundantly with KIN13A to modulate cell wall synthesis and cell expansion via the THE1 pathway.	Atkinesin-13A modulates cell-wall synthesis and cell expansion in Arabidopsis thaliana via the THESEUS1 pathway.2014 · DOI: 10.1371/journal.pgen.1004627
`At3g16630`	Internal motor kinesin involved in trichome morphogenesis.	An internal motor kinesin is associated with the Golgi apparatus and plays a role in trichome morphogenesis in Arabidopsis.2005 · DOI: 10.1091/mbc.e04-05-0400 AtKinesin-13A is located on Golgi-associated vesicle and involved in vesicle formation/budding in Arabidopsis root-cap peripheral cells.2009 · DOI: 10.1186/1471-2229-9-138 Rho of plant GTPase signaling regulates the behavior of Arabidopsis kinesin-13A to establish secondary cell wall patterns.2013 · DOI: 10.1105/tpc.113.117853 Atkinesin-13A modulates cell-wall synthesis and cell expansion in Arabidopsis thaliana via the THESEUS1 pathway.2014 · DOI: 10.1371/journal.pgen.1004627

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0625200`	Kinesin-like protein KIN-13B.	No verified direct reference in this release
`Os05g0154700`	Kinesin-like protein KIN-13A.	No verified direct reference in this release
`Os07g0479300`	Serine carboxypeptidase-like.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008482 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0007019 microtubule depolymerization Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0090058 metaxylem development Biological Process

GO:1903338 regulation of cell wall organization or biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005795 Golgi stack Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009531 secondary cell wall Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G16060

ath:AT3G16630

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.379

Rank 1 · TkA02G224720 · TK1151

Nucleus0.338

Rank 2 · TkA02G224720 · TK1151

Mitochondrion0.187

Rank 3 · TkA02G224720 · TK1151

Cell membrane0.118

Rank 4 · TkA02G224720 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA02G224720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450Peptidase_S102-39 aa

PF00225Kinesin61-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G224720	`PF00450`	Peptidase_S10	2	39	1.8e-08	34.9
TkA02G224720	`PF00225`	Kinesin	61	125	0.00033	20.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940Y8`	Arabidopsis thaliana	sp\|Q940Y8\|KN13B_ARATH Kinesin-like protein KIN-13B	74.000%	Swiss-Prot	Low
`Q940B8`	Arabidopsis thaliana	sp\|Q940B8\|KN13A_ARATH Kinesin-like protein KIN-13A	68.800%	Swiss-Prot	Low
`B9EY52`	Oryza sativa subsp. japonica	sp\|B9EY52\|KN13B_ORYSJ Kinesin-like protein KIN-13B	68.200%	Swiss-Prot	Low
`B9FMJ3`	Oryza sativa subsp. japonica	sp\|B9FMJ3\|KN13A_ORYSJ Kinesin-like protein KIN-13A	58.300%	Swiss-Prot	Low
`P52712`	Oryza sativa subsp. japonica	sp\|P52712\|CBPX_ORYSJ Serine carboxypeptidase-like	69.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card