Gene Card
Gene overview
cDNA / CDS / Protein Sequences
453 bp · TkA02G210230|TK1151|cDNA
ATGATCGTTTGCCTTGATTTTGTGCTTCTTACCCTTTCCACCATCACCGGCTGGTGTGTCATCGCTTCTTTCATTCTCACTTCCGTAGTCGGAGCTGGTTTCTTGGTTTATTTGATTGAGAGAGCAAAGAAGTGCTTGGATTTTTCTACCACCATTTACATCATCCATCTCTTCATATGCATCATATATGGAGGCTGGCCCACATCAATCACATGGTGGATTGTGAATGGCACCGGATTGACAGTAATGGCTTTGTTGGG...
453 bp · TkA02G210230|TK1151|CDS
ATGATCGTTTGCCTTGATTTTGTGCTTCTTACCCTTTCCACCATCACCGGCTGGTGTGTCATCGCTTCTTTCATTCTCACTTCCGTAGTCGGAGCTGGTTTCTTGGTTTATTTGATTGAGAGAGCAAAGAAGTGCTTGGATTTTTCTACCACCATTTACATCATCCATCTCTTCATATGCATCATATATGGAGGCTGGCCCACATCAATCACATGGTGGATTGTGAATGGCACCGGATTGACAGTAATGGCTTTGTTGGG...
Protein
Download Protein FASTA150 aa · TkA02G210230|TK1151|PROTEIN
MIVCLDFVLLTLSTITGWCVIASFILTSVVGAGFLVYLIERAKKCLDFSTTIYIIHLFICIIYGGWPTSITWWIVNGTGLTVMALLGEYIVHCLLMLLNKRTISIFSSSTGEKNWKFWHQNGKNRLILRMINGLMTRKQARFQFRNRYSV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G210230 |
|---|---|
| TK1151 ID | TkA02G210230 |
| OH-1004 ID | LXL04_008491 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 79.800 |
| Protein coverage (%) | TK1151 69.333 / OH-1004 67.105Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G210230 |
|---|---|
| Location | Chr02:53657564-53661445 (+) |
| Description | Similar to sys1: Protein SYS1 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006895 Golgi to endosome transport Biological Process GO:0034067 protein localization to Golgi apparatus Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0005829 cytosol Cellular Component GO:0032588 trans-Golgi network membrane Cellular Component |
| KEGG gene cross-reference | ddi:DDB_G0269368 hsa:90196 nve:5512228 panu:100137166 pon:100137180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF09801SYS19-91 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G210230 | PF09801 | SYS1 | 9 | 91 | 3.2e-25 | 89.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.